Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant E. coli Beta-lactamase CTX-M-1 (bla)

Recombinant E. coli Beta-lactamase CTX-M-1 (bla) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: E. coli. Target Name: bla. Target Synonyms: Beta-lactamase MEN-1Cefotaximase 1. Accession Number: P28585. Expression Region: 29~291aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 32.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant E. coli Beta-lactamase CTX-M-1 (bla) is a purified Recombinant Protein.

Accession Number

P28585

Expression Region

29~291aa

Host

E. coli

Target

Bla

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

32.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Beta-lactamase MEN-1Cefotaximase 1

Species

E. coli

Protein Name

Recombinant Protein

AA Sequence

QTADVQQKLAELERQSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAVAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVDGTMSLAELSAAALQYSDNVAMNKLISHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDPRDTTSPRAMAQTLRNLTLGKALGDSQRAQLVTWMKGNTTGAASIQAGLPASWVVGDKTGSGDYGTTNDIAVIWPKDRAPLILVTYFTQPQPKAESRRDVLASAAKIVTNGL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DcpS CRISPR Activation Plasmid (m)
sc-427369-ACT 20 µg

DcpS CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
Anti-AADACL1/NCEH1 Antibody Picoband®
A06478-1 100 µg/Vial

Anti-AADACL1/NCEH1 Antibody Picoband®

Sign In for Pricing
View Details
Cdca4 (BC012953) Mouse Tagged Lenti ORF Clone
MR202082L4 10 µg

Cdca4 (BC012953) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
TFIIE-α (E-2) AC
sc-133064 AC 500 µg/mL - 25% ag

TFIIE-α (E-2) AC

Sign In for Pricing
View Details
Human ADAMTS1 activation kit by CRISPRa
GA106357 1 Kit

Human ADAMTS1 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Ursus arctos Prostaglandin-H2 D-isomerase (PTGDS)
MBS1395172-01 0.02 mg (E-Coli)

Recombinant Ursus arctos Prostaglandin-H2 D-isomerase (PTGDS)

Sign In for Pricing
View Details