Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Carpinus betulus Major pollen allergen Car b 1 isoforms 1A and 1B

Recombinant Carpinus betulus Major pollen allergen Car b 1 isoforms 1A and 1B is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Carpinus betulus (European hornbeam) (Carpinus caucasica) . Target Name: Carpinus betulus Major pollen allergen Car b 1 isoforms 1A and 1B. Target Synonyms: Major pollen allergen Car b 1 isoforms 1A and 1B; Allergen Car b I; allergen Car b 1. Accession Number: P38949. Expression Region: 2~160aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 21.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Carpinus betulus Major pollen allergen Car b 1 isoforms 1A and 1B is a purified Recombinant Protein.

Accession Number

P38949

Expression Region

2~160aa

Host

E. coli

Target

Carpinus betulus Major pollen allergen Car b 1 isoforms 1A and 1B

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

21.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Major pollen allergen Car b 1 isoforms 1A and 1B; Allergen Car b I; allergen Car b 1

Species

Carpinus betulus (European hornbeam) (Carpinus caucasica)

Protein Name

Recombinant Protein

AA Sequence

GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQVISSVENVGGNGGPGTIKNITFAEGIPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKFHAKGYHEVNAEKMKGAKEMAEKLLRAVESYLLAHTAEYN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SOBP Human qPCR Template Standard (NM_018013)
HK210609 1 Kit

SOBP Human qPCR Template Standard (NM_018013)

Sign In for Pricing
View Details
DLL3 (NM_016941) Human Tagged Lenti ORF Clone
RC200005L4 10 µg

DLL3 (NM_016941) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
ING1 Human Recombinant Protein
TP724880 50 µg

ING1 Human Recombinant Protein

Sign In for Pricing
View Details
TAPA1/CD81 polyclonal antibody
BS91318 50ul

TAPA1/CD81 polyclonal antibody

Sign In for Pricing
View Details
TMEM44 Adenovirus (Mouse)
47053054 1.0 mL

TMEM44 Adenovirus (Mouse)

Sign In for Pricing
View Details
Olr1265 Recombinant Protein (Rat)
RP215699 100 µg

Olr1265 Recombinant Protein (Rat)

Sign In for Pricing
View Details