Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Carpinus betulus Major pollen allergen Car b 1 isoforms 1A and 1B

Recombinant Carpinus betulus Major pollen allergen Car b 1 isoforms 1A and 1B is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Carpinus betulus (European hornbeam) (Carpinus caucasica) . Target Name: Carpinus betulus Major pollen allergen Car b 1 isoforms 1A and 1B. Target Synonyms: Major pollen allergen Car b 1 isoforms 1A and 1B; Allergen Car b I; allergen Car b 1. Accession Number: P38949. Expression Region: 2~160aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 21.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Carpinus betulus Major pollen allergen Car b 1 isoforms 1A and 1B is a purified Recombinant Protein.

Accession Number

P38949

Expression Region

2~160aa

Host

E. coli

Target

Carpinus betulus Major pollen allergen Car b 1 isoforms 1A and 1B

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

21.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Major pollen allergen Car b 1 isoforms 1A and 1B; Allergen Car b I; allergen Car b 1

Species

Carpinus betulus (European hornbeam) (Carpinus caucasica)

Protein Name

Recombinant Protein

AA Sequence

GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQVISSVENVGGNGGPGTIKNITFAEGIPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKFHAKGYHEVNAEKMKGAKEMAEKLLRAVESYLLAHTAEYN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SEN1 (MORF4) Mouse Monoclonal Antibody [Clone ID: OTI5E6]
CF800387 100 µg

SEN1 (MORF4) Mouse Monoclonal Antibody [Clone ID: OTI5E6]

Sign In for Pricing
View Details
RN5S56 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV743123 1.0 µg DNA

RN5S56 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Slc26a3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3426306 1.0 µg DNA

Slc26a3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
MIR5090 Recombinant Protein (Human)
RP074067 100 µg

MIR5090 Recombinant Protein (Human)

Sign In for Pricing
View Details
Lancl1 Mouse qPCR Primer Pair (NM_021295)
MP207289 200 Reactions

Lancl1 Mouse qPCR Primer Pair (NM_021295)

Sign In for Pricing
View Details
Fmoc-Gly-Arg(Pbf)-OH
MBS407506-01 1 g

Fmoc-Gly-Arg(Pbf)-OH

Sign In for Pricing
View Details