Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Carpinus betulus Major pollen allergen Car b 1 isoforms 1A and 1B

Recombinant Carpinus betulus Major pollen allergen Car b 1 isoforms 1A and 1B is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Carpinus betulus (European hornbeam) (Carpinus caucasica) . Target Name: Carpinus betulus Major pollen allergen Car b 1 isoforms 1A and 1B. Target Synonyms: Major pollen allergen Car b 1 isoforms 1A and 1B; Allergen Car b I; allergen Car b 1. Accession Number: P38949. Expression Region: 2~160aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 21.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Carpinus betulus Major pollen allergen Car b 1 isoforms 1A and 1B is a purified Recombinant Protein.

Accession Number

P38949

Expression Region

2~160aa

Host

E. coli

Target

Carpinus betulus Major pollen allergen Car b 1 isoforms 1A and 1B

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

21.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Major pollen allergen Car b 1 isoforms 1A and 1B; Allergen Car b I; allergen Car b 1

Species

Carpinus betulus (European hornbeam) (Carpinus caucasica)

Protein Name

Recombinant Protein

AA Sequence

GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQVISSVENVGGNGGPGTIKNITFAEGIPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKFHAKGYHEVNAEKMKGAKEMAEKLLRAVESYLLAHTAEYN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal ZFP91 Antibody
NBP1-80138 100 µL

Rabbit Polyclonal ZFP91 Antibody

Sign In for Pricing
View Details
C14orf68 (SLC25A47) (NM_207117) Human Tagged ORF Clone
RC221734 10 µg

C14orf68 (SLC25A47) (NM_207117) Human Tagged ORF Clone

Sign In for Pricing
View Details
FANCA Protein, Human, Recombinant (His Tag)
PH51636I1 100 µg

FANCA Protein, Human, Recombinant (His Tag)

Sign In for Pricing
View Details
SEZ6 Protein Vector (Mouse) (pPM-C-His)
PV228389 500 ng

SEZ6 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
RALA Rabbit Polyclonal Antibody
HA500075 100 µL

RALA Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Vinculin (MV, MVCL, CMD1W, CMH15, HEL114, Metavinculin)
352638 100 µg

Vinculin (MV, MVCL, CMD1W, CMH15, HEL114, Metavinculin)

Sign In for Pricing
View Details