Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Carpinus betulus Major pollen allergen Car b 1 isoforms 1A and 1B

Recombinant Carpinus betulus Major pollen allergen Car b 1 isoforms 1A and 1B is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Carpinus betulus (European hornbeam) (Carpinus caucasica) . Target Name: Carpinus betulus Major pollen allergen Car b 1 isoforms 1A and 1B. Target Synonyms: Major pollen allergen Car b 1 isoforms 1A and 1B; Allergen Car b I; allergen Car b 1. Accession Number: P38949. Expression Region: 2~160aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 21.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Carpinus betulus Major pollen allergen Car b 1 isoforms 1A and 1B is a purified Recombinant Protein.

Accession Number

P38949

Expression Region

2~160aa

Host

E. coli

Target

Carpinus betulus Major pollen allergen Car b 1 isoforms 1A and 1B

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

21.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Major pollen allergen Car b 1 isoforms 1A and 1B; Allergen Car b I; allergen Car b 1

Species

Carpinus betulus (European hornbeam) (Carpinus caucasica)

Protein Name

Recombinant Protein

AA Sequence

GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQVISSVENVGGNGGPGTIKNITFAEGIPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKFHAKGYHEVNAEKMKGAKEMAEKLLRAVESYLLAHTAEYN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRMT6 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2471605 3x 1.0 µg

TRMT6 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Magic™ Membrane Protein Human RHBDL3 (Rhomboid like 3) Full Length
MPC1971K Each

Magic™ Membrane Protein Human RHBDL3 (Rhomboid like 3) Full Length

Sign In for Pricing
View Details
Rabbit Polyclonal PA28 Activator gamma Subunit/PSME3 Antibody [DyLight 350]
NBP3-00356UV 0.1 mL

Rabbit Polyclonal PA28 Activator gamma Subunit/PSME3 Antibody [DyLight 350]

Sign In for Pricing
View Details
Rabbit Polyclonal Thyroid receptor-interacting protein 13 Antibody [Alexa Fluor 488]
NBP2-04044AF488 0.1 mL

Rabbit Polyclonal Thyroid receptor-interacting protein 13 Antibody [Alexa Fluor 488]

Sign In for Pricing
View Details
Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) REC102 Polyclonal Antibody
MBS9015692 Inquire

Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) REC102 Polyclonal Antibody

Sign In for Pricing
View Details
Rat Spinal Cord Neuron Medium
ARM0367 500 mL

Rat Spinal Cord Neuron Medium

Sign In for Pricing
View Details