Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Protein S100-A8 (S100a8)

Recombinant Rat Protein S100-A8 (S100a8) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rat (Rattus norvegicus) . Target Name: S100a8. Target Synonyms: Calgranulin-AMigration inhibitory factor-related protein 8; MRP-8; p8S100 calcium-binding protein A8. Accession Number: P50115. Expression Region: 2~89aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 14.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Rat Protein S100-A8 (S100a8) is a purified Recombinant Protein.

Accession Number

P50115

Expression Region

2~89aa

Host

E. coli

Target

S100a8

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

14.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Calgranulin-AMigration inhibitory factor-related protein 8; MRP-8; p8S100 calcium-binding protein A8

Species

Rat (Rattus norvegicus)

Protein Name

Recombinant Protein

AA Sequence

ATELEKALSNVIEVYHNYSGIKGNHHALYRDDFRKMVTTECPQFVQNKNTESLFKELDVNSDNAINFEEFLVLVIRVGVAAHKDSHKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Inhibin Beta E (INHbE) ELISA Kit
EKN46050-01 48 Tests

Bovine Inhibin Beta E (INHbE) ELISA Kit

Sign In for Pricing
View Details
Bovine Inhibin Beta E (INHbE) ELISA Kit
EKN46050-02 96 Tests

Bovine Inhibin Beta E (INHbE) ELISA Kit

Sign In for Pricing
View Details
Bovine Inhibin Beta E (INHbE) ELISA Kit
EKN46050-03 5x 96 Tests

Bovine Inhibin Beta E (INHbE) ELISA Kit

Sign In for Pricing
View Details
Kank3 sgRNA CRISPR Lentivector (Rat) (Target 2)
K6140703 1.0 µg DNA

Kank3 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Phospho-RFA2 (Thr21) Antibody
E18-3183-2 100 µg -100 µL

Phospho-RFA2 (Thr21) Antibody

Sign In for Pricing
View Details
Rat Ovary cDNA-Random Primer
RD-406-RH 30 Reactions

Rat Ovary cDNA-Random Primer

Sign In for Pricing
View Details