Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Protein S100-A8 (S100a8)

Recombinant Rat Protein S100-A8 (S100a8) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rat (Rattus norvegicus) . Target Name: S100a8. Target Synonyms: Calgranulin-AMigration inhibitory factor-related protein 8; MRP-8; p8S100 calcium-binding protein A8. Accession Number: P50115. Expression Region: 2~89aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 14.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Rat Protein S100-A8 (S100a8) is a purified Recombinant Protein.

Accession Number

P50115

Expression Region

2~89aa

Host

E. coli

Target

S100a8

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

14.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Calgranulin-AMigration inhibitory factor-related protein 8; MRP-8; p8S100 calcium-binding protein A8

Species

Rat (Rattus norvegicus)

Protein Name

Recombinant Protein

AA Sequence

ATELEKALSNVIEVYHNYSGIKGNHHALYRDDFRKMVTTECPQFVQNKNTESLFKELDVNSDNAINFEEFLVLVIRVGVAAHKDSHKE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

INCENP (NM_001040694) Human Tagged Lenti ORF Clone
RC212647L3 10 µg

INCENP (NM_001040694) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
PLA2G2F Protein Vector (Rat) (pPM-C-HA)
36909026 500 ng

PLA2G2F Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
ROS inducer 2
HY-155661-01 1 mg

ROS inducer 2

Sign In for Pricing
View Details
ROS inducer 2
HY-155661-02 5 mg

ROS inducer 2

Sign In for Pricing
View Details
ROS inducer 2
HY-155661-03 10 mg

ROS inducer 2

Sign In for Pricing
View Details
Rabbit Polyclonal Factor VIII Antibody
NB100-91761 0.1 mg

Rabbit Polyclonal Factor VIII Antibody

Sign In for Pricing
View Details