Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Retinoschisin (RS1)

Recombinant Human Retinoschisin (RS1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: RS1. Target Synonyms: X-linked juvenile retinoschisis protein. Accession Number: O15537. Expression Region: 24~224aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 27kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Retinoschisin (RS1) is a purified Recombinant Protein.

Accession Number

O15537

Expression Region

24~224aa

Host

E. coli

Target

RS1

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Cell Adhesion

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

27kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

X-linked juvenile retinoschisis protein

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

STEDEGEDPWYQKACKCDCQGGPNALWSAGATSLDCIPECPYHKPLGFESGEVTPDQITCSNPEQYVGWYSSWTANKARLNSQGFGCAWLSKFQDSSQWLQIDLKEIKVISGILTQGRCDIDEWMTKYSVQYRTDERLNWIYYKDQTGNNRVFYGNSDRTSTVQNLLRPPIISRFIRLIPLGWHVRIAIRMELLECVSKCA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE-Linked Polyclonal Antibody to Kallikrein 9 (KLK9)
MBS2118201-01 0.1 mL

PE-Linked Polyclonal Antibody to Kallikrein 9 (KLK9)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Kallikrein 9 (KLK9)
MBS2118201-02 0.2 mL

PE-Linked Polyclonal Antibody to Kallikrein 9 (KLK9)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Kallikrein 9 (KLK9)
MBS2118201-03 0.5 mL

PE-Linked Polyclonal Antibody to Kallikrein 9 (KLK9)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Kallikrein 9 (KLK9)
MBS2118201-04 1 mL

PE-Linked Polyclonal Antibody to Kallikrein 9 (KLK9)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Kallikrein 9 (KLK9)
MBS2118201-05 5 mL

PE-Linked Polyclonal Antibody to Kallikrein 9 (KLK9)

Sign In for Pricing
View Details
C7orf34 Polyclonal Antibody, HRP Conjugated
bs-15264R-HRP 100 µL

C7orf34 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details