Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Fibroblast growth factor 23 (Fgf23)

Recombinant Rat Fibroblast growth factor 23 (Fgf23) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rat (Rattus norvegicus) . Target Name: Fgf23. Target Synonyms: Fgf23Fibroblast growth factor 23; FGF-23. Accession Number: Q8VI82. Expression Region: 25~251aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 29.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Rat Fibroblast growth factor 23 (Fgf23) is a purified Recombinant Protein.

Accession Number

Q8VI82

Expression Region

25~251aa

Host

E. coli

Target

Fgf23

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

29.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Fgf23Fibroblast growth factor 23; FGF-23

Species

Rat (Rattus norvegicus)

Protein Name

Recombinant Protein

AA Sequence

YSDTSPLLGSNWGSLTHLYTATARNSYHLQIHRDGHVDGTPHQTIYSALMITSEDAGSVVIIGAMTRRFLCMDLRGNIFGSYHFSPENCRFRQWTLENGYDVYLSPKHHYLVSLGRSKRIFQPGTNPPPFSQFLARRNEVPLLHFYTARPRRHTRSAEDPPERDPLNVLKPRPRATPIPVSCSRELPSAEEGGPAASDPLGVLRRGRGDARRGAGGTDRCRPFPRFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CD64/FCGR1A Antibody Picoband®, HRP Conjugate
A02428-3-HRP 100 µg/Vial

Anti-CD64/FCGR1A Antibody Picoband®, HRP Conjugate

Sign In for Pricing
View Details
Haspin shRNA (m) Lentiviral Particles
sc-45798-V 200 µL

Haspin shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
Anti-African malaria mosquito CTLMA2 Antibody Fluoro594 Conjugated
DZ41078-Fluoro594 200 µL/Vial

Anti-African malaria mosquito CTLMA2 Antibody Fluoro594 Conjugated

Sign In for Pricing
View Details
CD21 (CR2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6C7]
TA814212AM 100 µL

CD21 (CR2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6C7]

Sign In for Pricing
View Details
Scpep1 (NM_133383) Rat Tagged Lenti ORF Clone
RR204250L3 10 µg

Scpep1 (NM_133383) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Anti-Carbonic Anhydrase III Antibody, Rabbit Monoclonal
MBS8103022-01 0.1 mL

Recombinant Anti-Carbonic Anhydrase III Antibody, Rabbit Monoclonal

Sign In for Pricing
View Details