Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Fibroblast growth factor 23 (Fgf23)

Recombinant Rat Fibroblast growth factor 23 (Fgf23) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rat (Rattus norvegicus) . Target Name: Fgf23. Target Synonyms: Fgf23Fibroblast growth factor 23; FGF-23. Accession Number: Q8VI82. Expression Region: 25~251aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 29.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Rat Fibroblast growth factor 23 (Fgf23) is a purified Recombinant Protein.

Accession Number

Q8VI82

Expression Region

25~251aa

Host

E. coli

Target

Fgf23

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

29.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Fgf23Fibroblast growth factor 23; FGF-23

Species

Rat (Rattus norvegicus)

Protein Name

Recombinant Protein

AA Sequence

YSDTSPLLGSNWGSLTHLYTATARNSYHLQIHRDGHVDGTPHQTIYSALMITSEDAGSVVIIGAMTRRFLCMDLRGNIFGSYHFSPENCRFRQWTLENGYDVYLSPKHHYLVSLGRSKRIFQPGTNPPPFSQFLARRNEVPLLHFYTARPRRHTRSAEDPPERDPLNVLKPRPRATPIPVSCSRELPSAEEGGPAASDPLGVLRRGRGDARRGAGGTDRCRPFPRFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF354B Human qPCR Primer Pair (NM_058230)
HP216655 200 Reactions

ZNF354B Human qPCR Primer Pair (NM_058230)

Sign In for Pricing
View Details
Rabbit Monoclonal Tau Antibody (Tau-5) [Alexa Fluor 350]
NBP2-81091AF350 0.1 mL

Rabbit Monoclonal Tau Antibody (Tau-5) [Alexa Fluor 350]

Sign In for Pricing
View Details
Rabbit anti ATF-2 (Ab-69 or 51)
AP21030 100 µL

Rabbit anti ATF-2 (Ab-69 or 51)

Sign In for Pricing
View Details
Pancreatic Polypeptide CRISPR Activation Plasmid (m2)
sc-422391-ACT-2 20 µg

Pancreatic Polypeptide CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
1110012L19Rik siRNA (m)
sc-108152 10 µM

1110012L19Rik siRNA (m)

Sign In for Pricing
View Details
GPD2 CRISPR/Cas9 KO Plasmid (m)
sc-420531 20 µg

GPD2 CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details