Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse H-2 class II histocompatibility antigen gamma chain (Cd74), partial

Recombinant Mouse H-2 class II histocompatibility antigen gamma chain (Cd74), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Cd74. Target Synonyms: Ia antigen-associated invariant chain; IiMHC class II-associated invariant chain; CD74. Accession Number: P04441. Expression Region: 56~279aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 29.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse H-2 class II histocompatibility antigen gamma chain (Cd74), partial is a purified Recombinant Protein.

Accession Number

P04441

Expression Region

56~279aa

Host

E. coli

Target

Cd74

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Extracellular Domain

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

29.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Ia antigen-associated invariant chain; IiMHC class II-associated invariant chain; CD74

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

QQQGRLDKLTITSQNLQLESLRMKLPKSAKPVSQMRMATPLLMRPMSMDNMLLGPVKNVTKYGNMTQDHVMHLLTRSGPLEYPQLKGTFPENLKHLKNSMDGVNWKIFESWMKQWLLFEMSKNSLEEKKPTEAPPKVLTKCQEEVSHIPAVYPGAFRPKCDENGNYLPLQCHGSTGYCWCVFPNGTEVPHTKSRGRHNCSEPLDMEDLSSGLGVTRQELGQVTL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Desmocollin 3 (DSC3) (NM_001941) Human Tagged ORF Clone Lentiviral Particle
RC215512L3V 200 µL

Desmocollin 3 (DSC3) (NM_001941) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Prokaryotic Human Immunodeficiency Virus 1
RPU60904-01 50 µg

Prokaryotic Human Immunodeficiency Virus 1

Sign In for Pricing
View Details
Prokaryotic Human Immunodeficiency Virus 1
RPU60904-02 100 µg

Prokaryotic Human Immunodeficiency Virus 1

Sign In for Pricing
View Details
Prokaryotic Human Immunodeficiency Virus 1
RPU60904-03 1 mg

Prokaryotic Human Immunodeficiency Virus 1

Sign In for Pricing
View Details
PIGG (NM_017733) Human Tagged Lenti ORF Clone
RC214539L4 10 µg

PIGG (NM_017733) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
HAVCR1 Knockout TE1 Polyclonal Cells
ARG36854 1 Million

HAVCR1 Knockout TE1 Polyclonal Cells

Sign In for Pricing
View Details