Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Complement C1q subcomponent subunit A (C1qa)

Recombinant Mouse Complement C1q subcomponent subunit A (C1qa) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: C1qa. Target Synonyms: C1qaComplement C1q subcomponent subunit A. Accession Number: P98086. Expression Region: 23~245aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 39.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse Complement C1q subcomponent subunit A (C1qa) is a purified Recombinant Protein.

Accession Number

P98086

Expression Region

23~245aa

Host

E. coli

Target

C1qa

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

39.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

C1qaComplement C1q subcomponent subunit A

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

EDVCRAPNGKDGAPGNPGRPGRPGLKGERGEPGAAGIRTGIRGFKGDPGESGPPGKPGNVGLPGPSGPLGDSGPQGLKGVKGNPGNIRDQPRPAFSAIRQNPMTLGNVVIFDKVLTNQESPYQNHTGRFICAVPGFYYFNFQVISKWDLCLFIKSSSGGQPRDSLSFSNTNNKGLFQVLAGGTVLQLRRGDEVWIEKDPAKGRIYQGTEADSIFSGFLIFPSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OCIAD1 Rabbit Polyclonal Antibody
orb629506-01 50 µg

OCIAD1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
OCIAD1 Rabbit Polyclonal Antibody
orb629506-02 100 µg

OCIAD1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Anti-α-Gal Epitope (Galα1-3Galβ1-4GlcNAc-R) (B1H12) (Mouse, Monoclonal, IgG1)
A128951 100 µL

Anti-α-Gal Epitope (Galα1-3Galβ1-4GlcNAc-R) (B1H12) (Mouse, Monoclonal, IgG1)

Sign In for Pricing
View Details
CCM2 antibody
10R-3606 100 µL

CCM2 antibody

Sign In for Pricing
View Details
Cyclin A1 antibody
70R-51682 100 µL

Cyclin A1 antibody

Sign In for Pricing
View Details
Rabbit Anti-Chemokine Receptor D6 antibody
SL13897R-01 50 µL

Rabbit Anti-Chemokine Receptor D6 antibody

Sign In for Pricing
View Details