Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Lys-63-specific deubiquitinase BRCC36 (BRCC3)

Recombinant Human Lys-63-specific deubiquitinase BRCC36 (BRCC3) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: BRCC3. Target Synonyms: BRCA1-A complex subunit BRCC36BRCA1/BRCA2-containing complex subunit 3BRCA1/BRCA2-containing complex subunit 36BRISC complex subunit BRCC36. Accession Number: P46736. Expression Region: 2~316aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 51.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Lys-63-specific deubiquitinase BRCC36 (BRCC3) is a purified Recombinant Protein.

Accession Number

P46736

Expression Region

2~316aa

Host

E. coli

Target

BRCC3

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Field of Research

Cell Biology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

51.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

BRCA1-A complex subunit BRCC36BRCA1/BRCA2-containing complex subunit 3BRCA1/BRCA2-containing complex subunit 36BRISC complex subunit BRCC36

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

AVQVVQAVQAVHLESDAFLVCLNHALSTEKEEVMGLCIGELNDDTRSDSKFAYTGTEMRTVAEKVDAVRIVHIHSVIILRRSDKRKDRVEISPEQLSAASTEAERLAELTGRPMRVVGWYHSHPHITVWPSHVDVRTQAMYQMMDQGFVGLIFSCFIEDKNTKTGRVLYTCFQSIQAQKSSESLHGPRDFWSSSQHISIEGQKEEERYERIEIPIHIVPHVTIGKVCLESAVELPKILCQEEQDAYRRIHSLTHLDSVTKIHNGSVFTKNLCSQMSAVSGPLLQWLEDRLEQNQQHLQELQQEKEELMQELSSLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PMS1 Polyclonal Antibody, Cy5.5 Conjugated
bs-8579R-Cy5.5 100 µL

PMS1 Polyclonal Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
NEMP2 (NM_001142645) Human Tagged Lenti ORF Clone
RC227506L3 10 µg

NEMP2 (NM_001142645) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Compound NP-024544
MBS5792922 Inquire

Compound NP-024544

Sign In for Pricing
View Details
C9orf50 Rabbit Polyclonal Antibody (HRP)
orb478395 100 µL

C9orf50 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Gltpd1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K7279506 1.0 µg DNA

Gltpd1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
NIT1 Antibody; HRP conjugated
MBS7001453-01 0.05 mg

NIT1 Antibody; HRP conjugated

Sign In for Pricing
View Details