Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Lys-63-specific deubiquitinase BRCC36 (BRCC3)

Recombinant Human Lys-63-specific deubiquitinase BRCC36 (BRCC3) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: BRCC3. Target Synonyms: BRCA1-A complex subunit BRCC36BRCA1/BRCA2-containing complex subunit 3BRCA1/BRCA2-containing complex subunit 36BRISC complex subunit BRCC36. Accession Number: P46736. Expression Region: 2~316aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 51.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Lys-63-specific deubiquitinase BRCC36 (BRCC3) is a purified Recombinant Protein.

Accession Number

P46736

Expression Region

2~316aa

Host

E. coli

Target

BRCC3

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Field of Research

Cell Biology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

51.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

BRCA1-A complex subunit BRCC36BRCA1/BRCA2-containing complex subunit 3BRCA1/BRCA2-containing complex subunit 36BRISC complex subunit BRCC36

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

AVQVVQAVQAVHLESDAFLVCLNHALSTEKEEVMGLCIGELNDDTRSDSKFAYTGTEMRTVAEKVDAVRIVHIHSVIILRRSDKRKDRVEISPEQLSAASTEAERLAELTGRPMRVVGWYHSHPHITVWPSHVDVRTQAMYQMMDQGFVGLIFSCFIEDKNTKTGRVLYTCFQSIQAQKSSESLHGPRDFWSSSQHISIEGQKEEERYERIEIPIHIVPHVTIGKVCLESAVELPKILCQEEQDAYRRIHSLTHLDSVTKIHNGSVFTKNLCSQMSAVSGPLLQWLEDRLEQNQQHLQELQQEKEELMQELSSLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Middle Ear Epithelial Cell Medium
ARM0016 500 mL

Human Middle Ear Epithelial Cell Medium

Sign In for Pricing
View Details
Rabbit Anti Presynaptic Membrane Receptor Antibody ELISA kit
GTR10452550 96 Well

Rabbit Anti Presynaptic Membrane Receptor Antibody ELISA kit

Sign In for Pricing
View Details
Mmu-miR-7026-3p miRNA Inhibitor
orb1869396-01 10 nmol

Mmu-miR-7026-3p miRNA Inhibitor

Sign In for Pricing
View Details
Mmu-miR-7026-3p miRNA Inhibitor
orb1869396-02 20 nmol

Mmu-miR-7026-3p miRNA Inhibitor

Sign In for Pricing
View Details
LOC684996 3'UTR GFP Stable Cell Line
TU261159 1.0 mL

LOC684996 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
S-3-Amino-3- (4-hydroxyphenyl) propionic acid 98+% (Chiral HPLC)
241847-01 100 mg

S-3-Amino-3- (4-hydroxyphenyl) propionic acid 98+% (Chiral HPLC)

Sign In for Pricing
View Details