Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human ATP synthase subunit delta, mitochondrial (ATP5D)

Recombinant Human ATP synthase subunit delta, mitochondrial (ATP5D) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: ATP5D. Target Synonyms: F-ATPase delta subunit. Accession Number: P30049. Expression Region: 23~168aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 31kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human ATP synthase subunit delta, mitochondrial (ATP5D) is a purified Recombinant Protein.

Accession Number

P30049

Expression Region

23~168aa

Host

E. coli

Target

ATP5D

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Field of Research

Metabolism

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

31kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

F-ATPase delta subunit

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

AEAAAAPAAASGPNQMSFTFASPTQVFFNGANVRQVDVPTLTGAFGILAAHVPTLQVLRPGLVVVHAEDGTTSKYFVSSGSIAVNADSSVQLLAEEAVTLDMLDLGAAKANLEKAQAELVGTADEATRAEIQIRIEANEALVKALE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

9,9'-Spirobi[9H-fluoren]-3-amine, N-phenyl-
JH920137 1 Each

9,9'-Spirobi[9H-fluoren]-3-amine, N-phenyl-

Sign In for Pricing
View Details
Camsap1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6468908 1.0 µg DNA

Camsap1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Vmn2r45 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K3097602 1.0 µg DNA

Vmn2r45 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
UBE2S Antibody
E311814 200 µL

UBE2S Antibody

Sign In for Pricing
View Details
Rabbit anti-human DPH1 homolog (S. cerevisiae) polyclonal Antibody
MBS710833-01 0.1 mL

Rabbit anti-human DPH1 homolog (S. cerevisiae) polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-human DPH1 homolog (S. cerevisiae) polyclonal Antibody
MBS710833-02 5x 0.1 mL

Rabbit anti-human DPH1 homolog (S. cerevisiae) polyclonal Antibody

Sign In for Pricing
View Details