Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TGFBR1/ALK-5, Human (HEK293, Fc)

TGFBR1/ALK-5 proteins cooperate with TGFBR2 to form dedicated receptors for TGFB1, TGFB2, and TGFB3, transmitting signals and coordinating different physiological and pathological processes. It induces cell cycle arrest, modulates mesenchymal cell dynamics, contributes to wound healing, and affects immunosuppression and carcinogenesis. TGFBR1/ALK-5 Protein, Human (HEK293, Fc) is the recombinant human-derived TGFBR1/ALK-5 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

TGFBR1/ALK-5 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tgfbr1-alk-5-protein-human-hek-293-fc.html

Purity

97.83

Smiles

LQCFCHLCTKDNFTCVTDGLCFVSVTETTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTGSVTTTYCCNQDHCNKIELPTTVKSSPGLGPVE

Molecular Formula

7046 (Gene_ID) P36897-1 (L34-E125) (Accession)

Molecular Weight

Approximately 40-60 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Resistin Antibody [Allophycocyanin]
NB200-203APC 0.1 mL

Rabbit Polyclonal Resistin Antibody [Allophycocyanin]

Sign In for Pricing
View Details
Rabbit anti-RAD54A Antibody
YLD6622-01 50 µL

Rabbit anti-RAD54A Antibody

Sign In for Pricing
View Details
Rabbit anti-RAD54A Antibody
YLD6622-02 100 µL

Rabbit anti-RAD54A Antibody

Sign In for Pricing
View Details
Mouse Monoclonal ETS1 associated protein II Antibody (TDP2/1258) [Alexa Fluor 594]
NBP2-50071AF594 0.1 mL

Mouse Monoclonal ETS1 associated protein II Antibody (TDP2/1258) [Alexa Fluor 594]

Sign In for Pricing
View Details
CD3E (NM_000733) Human Recombinant Protein
TP762714 50 µg

CD3E (NM_000733) Human Recombinant Protein

Sign In for Pricing
View Details
hsa-miR-548f-5p miRNA Inhibitor
MBS8294895-01 10 nmol

hsa-miR-548f-5p miRNA Inhibitor

Sign In for Pricing
View Details