Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A1, Human (His)

S100A1 is a small calcium-binding protein that plays critical roles in multiple processes, including Ca (2+) homeostasis and cardiomyocyte regulation. Elevated intracellular Ca (2+) triggers conformational changes in S100A1, thereby interacting with key proteins in cardiomyocytes such as RYR1, RYR2, ATP2A2 and F1-ATPase. S100A1 Protein, Human (His) is the recombinant human-derived S100A1 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

S100A1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100a1-protein-human-his.html

Purity

95.0

Smiles

MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS

Molecular Formula

6271 (Gene_ID) P23297 (M1-S94) (Accession)

Molecular Weight

Approximately 11.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MZT1 (NM_001071775) Human Over-expression Lysate
LY420701 100 µg

MZT1 (NM_001071775) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse OXA (Orexin A) ELISA Kit
E-EL-M0860-01 24 Tests

Mouse OXA (Orexin A) ELISA Kit

Sign In for Pricing
View Details
Mouse OXA (Orexin A) ELISA Kit
E-EL-M0860-02 48 Tests

Mouse OXA (Orexin A) ELISA Kit

Sign In for Pricing
View Details
Mouse OXA (Orexin A) ELISA Kit
E-EL-M0860-03 96 Tests

Mouse OXA (Orexin A) ELISA Kit

Sign In for Pricing
View Details
Espin (ESPN) (NM_031475) Human Recombinant Protein
TP312577M 100 µg

Espin (ESPN) (NM_031475) Human Recombinant Protein

Sign In for Pricing
View Details
Occludin (OCLN) (Tight Junctions Marker) (OCLN/2183), CF740 conjugate, 0.1mg/mL
BNC742183-100 1x 100 µL

Occludin (OCLN) (Tight Junctions Marker) (OCLN/2183), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details