Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A1, Human (His)

S100A1 is a small calcium-binding protein that plays critical roles in multiple processes, including Ca (2+) homeostasis and cardiomyocyte regulation. Elevated intracellular Ca (2+) triggers conformational changes in S100A1, thereby interacting with key proteins in cardiomyocytes such as RYR1, RYR2, ATP2A2 and F1-ATPase. S100A1 Protein, Human (His) is the recombinant human-derived S100A1 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

S100A1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100a1-protein-human-his.html

Purity

95.0

Smiles

MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS

Molecular Formula

6271 (Gene_ID) P23297 (M1-S94) (Accession)

Molecular Weight

Approximately 11.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cd4 Rat Monoclonal Antibody [Clone ID: GK1.5]
AM26029AC-N 100 µg

Cd4 Rat Monoclonal Antibody [Clone ID: GK1.5]

Sign In for Pricing
View Details
Recombinant FKBP38 Antibody
RC-16238-01 50 μL

Recombinant FKBP38 Antibody

Sign In for Pricing
View Details
Recombinant FKBP38 Antibody
RC-16238-02 100 µL

Recombinant FKBP38 Antibody

Sign In for Pricing
View Details
Recombinant FKBP38 Antibody
RC-16238-03 1 mL

Recombinant FKBP38 Antibody

Sign In for Pricing
View Details
Desmoglein 1 (DSG1) Human Gene Knockout Kit (CRISPR)
KN418157 1 Kit

Desmoglein 1 (DSG1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Phospho-Tau (T217) Recombinant Rabbit monoclonal Antibody
HA723877 100 µL

Phospho-Tau (T217) Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details