Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A1, Human (His)

S100A1 is a small calcium-binding protein that plays critical roles in multiple processes, including Ca (2+) homeostasis and cardiomyocyte regulation. Elevated intracellular Ca (2+) triggers conformational changes in S100A1, thereby interacting with key proteins in cardiomyocytes such as RYR1, RYR2, ATP2A2 and F1-ATPase. S100A1 Protein, Human (His) is the recombinant human-derived S100A1 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

S100A1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100a1-protein-human-his.html

Purity

95.0

Smiles

MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS

Molecular Formula

6271 (Gene_ID) P23297 (M1-S94) (Accession)

Molecular Weight

Approximately 11.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ANKLE2 Double Nickase Plasmid (h)
sc-411675-NIC 20 µg

ANKLE2 Double Nickase Plasmid (h)

Sign In for Pricing
View Details
HPX Recombinant Protein (Mouse)
RP142346 100 µg

HPX Recombinant Protein (Mouse)

Sign In for Pricing
View Details
HDX Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-15435R-APC-Cy5.5 100 µL

HDX Polyclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
TMEM67 Polyclonal Antibody
RD88246A-01 60 μL

TMEM67 Polyclonal Antibody

Sign In for Pricing
View Details
TMEM67 Polyclonal Antibody
RD88246A-02 120 μL

TMEM67 Polyclonal Antibody

Sign In for Pricing
View Details
TMEM67 Polyclonal Antibody
RD88246A-03 200 µL

TMEM67 Polyclonal Antibody

Sign In for Pricing
View Details