Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nucleophosmin/Npm1, Human (193a.a, His)

The nucleophosmin/Npm1 protein plays critical roles in ribosome biogenesis, centrosome duplication, protein chaperones, histone assembly, and cell proliferation. Npm1 is a key player in the cellular orchestra that promotes ribosome nuclear export, associates with nucleolar ribonucleoprotein structures, and interacts with single-stranded nucleic acids. Nucleophosmin/Npm1 Protein, Human (193a.a, His) is the recombinant human-derived Nucleophosmin/Npm1 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

Nucleophosmin/Npm1 Protein, Human (193a.a, His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nucleophosmin-npm1-protein-human-his.html

Purity

96.00

Smiles

EDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL

Molecular Formula

4869 (Gene_ID) P06748-1 (E2-L294) (Accession)

Molecular Weight

Approximately 35 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse TAS2R135 shRNA Plasmid
abx983956-01 150 µg

Mouse TAS2R135 shRNA Plasmid

Sign In for Pricing
View Details
Mouse TAS2R135 shRNA Plasmid
abx983956-02 300 µg

Mouse TAS2R135 shRNA Plasmid

Sign In for Pricing
View Details
Acetonitrile HPLC
3120300 1 Each

Acetonitrile HPLC

Sign In for Pricing
View Details
Horse MMP2 (Matrix Metalloproteinase 2) ELISA Kit
EEq27130 96 Tests

Horse MMP2 (Matrix Metalloproteinase 2) ELISA Kit

Sign In for Pricing
View Details
Thyroxine (T4) (PE) discontinued
T5460-01-PE 100 µL

Thyroxine (T4) (PE) discontinued

Sign In for Pricing
View Details
Human hsa-miR-6134 miRNA Antagomir
abx887224-01 10 nmol

Human hsa-miR-6134 miRNA Antagomir

Sign In for Pricing
View Details