Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nucleophosmin/Npm1, Human (193a.a, His)

The nucleophosmin/Npm1 protein plays critical roles in ribosome biogenesis, centrosome duplication, protein chaperones, histone assembly, and cell proliferation. Npm1 is a key player in the cellular orchestra that promotes ribosome nuclear export, associates with nucleolar ribonucleoprotein structures, and interacts with single-stranded nucleic acids. Nucleophosmin/Npm1 Protein, Human (193a.a, His) is the recombinant human-derived Nucleophosmin/Npm1 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

Nucleophosmin/Npm1 Protein, Human (193a.a, His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nucleophosmin-npm1-protein-human-his.html

Purity

96.00

Smiles

EDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL

Molecular Formula

4869 (Gene_ID) P06748-1 (E2-L294) (Accession)

Molecular Weight

Approximately 35 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Swertiajaponin
301018 5 mg

Swertiajaponin

Sign In for Pricing
View Details
Olfr544 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4207502 1.0 µg DNA

Olfr544 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
ZSCAN16 Antibody
GWB-MN161H 50 µg

ZSCAN16 Antibody

Sign In for Pricing
View Details
Sheep Islet amyloid Polypeptide, IAPP GENLISA ELISA
KLS0009 96 Well

Sheep Islet amyloid Polypeptide, IAPP GENLISA ELISA

Sign In for Pricing
View Details
KRT40 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1177406 1.0 µg DNA

KRT40 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Recombinant Human ALPL Protein, N-His
HY127012-01 50 µg

Recombinant Human ALPL Protein, N-His

Sign In for Pricing
View Details