Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nucleophosmin/Npm1, Human (193a.a, His)

The nucleophosmin/Npm1 protein plays critical roles in ribosome biogenesis, centrosome duplication, protein chaperones, histone assembly, and cell proliferation. Npm1 is a key player in the cellular orchestra that promotes ribosome nuclear export, associates with nucleolar ribonucleoprotein structures, and interacts with single-stranded nucleic acids. Nucleophosmin/Npm1 Protein, Human (193a.a, His) is the recombinant human-derived Nucleophosmin/Npm1 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

Nucleophosmin/Npm1 Protein, Human (193a.a, His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nucleophosmin-npm1-protein-human-his.html

Purity

96.00

Smiles

EDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL

Molecular Formula

4869 (Gene_ID) P06748-1 (E2-L294) (Accession)

Molecular Weight

Approximately 35 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTGER3 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
38082066 1.0 µg DNA

PTGER3 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Human Optineurin (OPTN) ELISA Kit
RD-OPTN-Hu-01 96 Tests

Human Optineurin (OPTN) ELISA Kit

Sign In for Pricing
View Details
Human Optineurin (OPTN) ELISA Kit
RD-OPTN-Hu-02 48 Tests

Human Optineurin (OPTN) ELISA Kit

Sign In for Pricing
View Details
Human Acidic Ribosomal Phosphoprotein P2 (RPLP2) ELISA Kit
YP-W101664-01 48 Tests

Human Acidic Ribosomal Phosphoprotein P2 (RPLP2) ELISA Kit

Sign In for Pricing
View Details
Human Acidic Ribosomal Phosphoprotein P2 (RPLP2) ELISA Kit
YP-W101664-02 96 Tests

Human Acidic Ribosomal Phosphoprotein P2 (RPLP2) ELISA Kit

Sign In for Pricing
View Details
Diayangambin
HY-N11906 1 Each

Diayangambin

Sign In for Pricing
View Details