Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nucleophosmin/Npm1, Human (193a.a, His)

The nucleophosmin/Npm1 protein plays critical roles in ribosome biogenesis, centrosome duplication, protein chaperones, histone assembly, and cell proliferation. Npm1 is a key player in the cellular orchestra that promotes ribosome nuclear export, associates with nucleolar ribonucleoprotein structures, and interacts with single-stranded nucleic acids. Nucleophosmin/Npm1 Protein, Human (193a.a, His) is the recombinant human-derived Nucleophosmin/Npm1 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

Nucleophosmin/Npm1 Protein, Human (193a.a, His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nucleophosmin-npm1-protein-human-his.html

Purity

96.00

Smiles

EDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL

Molecular Formula

4869 (Gene_ID) P06748-1 (E2-L294) (Accession)

Molecular Weight

Approximately 35 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sclt1 3'UTR GFP Stable Cell Line
TU269977 1.0 mL

Sclt1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
TACC3 (T813) polyclonal antibody
BS2580-01 50 µL

TACC3 (T813) polyclonal antibody

Sign In for Pricing
View Details
TACC3 (T813) polyclonal antibody
BS2580-02 100 µL

TACC3 (T813) polyclonal antibody

Sign In for Pricing
View Details
RPS6P16 CRISPRa sgRNA lentivector (set of three targets)(Human)
42610121 3x 1.0µg DNA

RPS6P16 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
rac-Synephrine Hydrochloride
TRC-S920001-10MG 10 mg

rac-Synephrine Hydrochloride

Sign In for Pricing
View Details
GINS1, NT (GINS1, KIAA0186, PSF1, DNA replication complex GINS protein PSF1, GINS complex subunit 1) (MaxLight 490)
MBS6302265-01 0.1 mL

GINS1, NT (GINS1, KIAA0186, PSF1, DNA replication complex GINS protein PSF1, GINS complex subunit 1) (MaxLight 490)

Sign In for Pricing
View Details