Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nucleophosmin/Npm1, Human (193a.a, His)

The nucleophosmin/Npm1 protein plays critical roles in ribosome biogenesis, centrosome duplication, protein chaperones, histone assembly, and cell proliferation. Npm1 is a key player in the cellular orchestra that promotes ribosome nuclear export, associates with nucleolar ribonucleoprotein structures, and interacts with single-stranded nucleic acids. Nucleophosmin/Npm1 Protein, Human (193a.a, His) is the recombinant human-derived Nucleophosmin/Npm1 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

Nucleophosmin/Npm1 Protein, Human (193a.a, His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nucleophosmin-npm1-protein-human-his.html

Purity

96.00

Smiles

EDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL

Molecular Formula

4869 (Gene_ID) P06748-1 (E2-L294) (Accession)

Molecular Weight

Approximately 35 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human MEX3B Pre-designed siRNA Set A
SI009501A 1 Each

Human MEX3B Pre-designed siRNA Set A

Sign In for Pricing
View Details
Dynactin Subunit 3 (DCTN3) Antibody
abx431970 200 µL

Dynactin Subunit 3 (DCTN3) Antibody

Sign In for Pricing
View Details
Recombinant Human SMARCA2 Protein, His-SUMO, E.coli-50ug
QP6698-ec-50ug 50ug

Recombinant Human SMARCA2 Protein, His-SUMO, E.coli-50ug

Sign In for Pricing
View Details
Reg2 Mouse siRNA Oligo Duplex (Locus ID 19693)
SR404071 1 Kit

Reg2 Mouse siRNA Oligo Duplex (Locus ID 19693)

Sign In for Pricing
View Details
Clivorine
MF-0151635 25 mg

Clivorine

Sign In for Pricing
View Details
Nerve Growth Factor, beta (NGFb) (PE)
N2350-07A-PE 100 µL

Nerve Growth Factor, beta (NGFb) (PE)

Sign In for Pricing
View Details