Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nucleophosmin/Npm1, Human (193a.a, His)

The nucleophosmin/Npm1 protein plays critical roles in ribosome biogenesis, centrosome duplication, protein chaperones, histone assembly, and cell proliferation. Npm1 is a key player in the cellular orchestra that promotes ribosome nuclear export, associates with nucleolar ribonucleoprotein structures, and interacts with single-stranded nucleic acids. Nucleophosmin/Npm1 Protein, Human (193a.a, His) is the recombinant human-derived Nucleophosmin/Npm1 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

Nucleophosmin/Npm1 Protein, Human (193a.a, His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nucleophosmin-npm1-protein-human-his.html

Purity

96.00

Smiles

EDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL

Molecular Formula

4869 (Gene_ID) P06748-1 (E2-L294) (Accession)

Molecular Weight

Approximately 35 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken H-Cadherin (CDH13) ELISA Kit
MBS9373413 Inquire

Chicken H-Cadherin (CDH13) ELISA Kit

Sign In for Pricing
View Details
Anti-KCNC3
Y158040 100 µL

Anti-KCNC3

Sign In for Pricing
View Details
USP44 Antibody
A41705-50UG 50 µg

USP44 Antibody

Sign In for Pricing
View Details
Anti-DDX4 (Rabbit, Monoclonal)
A111882 100 µL

Anti-DDX4 (Rabbit, Monoclonal)

Sign In for Pricing
View Details
Recombinant Human CD40L / CD40 Ligand, Animal Free & Carrier Free
C-CYP226-100ug 100 µg

Recombinant Human CD40L / CD40 Ligand, Animal Free & Carrier Free

Sign In for Pricing
View Details
Rabbit Polyclonal NAC1 Antibody [Alexa Fluor 647]
NBP2-97154AF647 0.1 mL

Rabbit Polyclonal NAC1 Antibody [Alexa Fluor 647]

Sign In for Pricing
View Details