Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nucleophosmin/Npm1, Human (193a.a, His)

The nucleophosmin/Npm1 protein plays critical roles in ribosome biogenesis, centrosome duplication, protein chaperones, histone assembly, and cell proliferation. Npm1 is a key player in the cellular orchestra that promotes ribosome nuclear export, associates with nucleolar ribonucleoprotein structures, and interacts with single-stranded nucleic acids. Nucleophosmin/Npm1 Protein, Human (193a.a, His) is the recombinant human-derived Nucleophosmin/Npm1 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

Nucleophosmin/Npm1 Protein, Human (193a.a, His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nucleophosmin-npm1-protein-human-his.html

Purity

96.00

Smiles

EDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL

Molecular Formula

4869 (Gene_ID) P06748-1 (E2-L294) (Accession)

Molecular Weight

Approximately 35 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF645 sgRNA CRISPR Lentivector (Human) (Target 2)
K2722103 1.0 µg DNA

ZNF645 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Rat Interleukin 34 (IL34) ELISA Kit
RD-IL34-Ra-48Tests 48 Tests

Rat Interleukin 34 (IL34) ELISA Kit

Sign In for Pricing
View Details
NucleoSpin miRNA
MN 740971.50 50 Preparations

NucleoSpin miRNA

Sign In for Pricing
View Details
SPFH2 (ERLIN2) Rabbit Polyclonal Antibody
TA344331 100 µL

SPFH2 (ERLIN2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MCM3 Rabbit Polyclonal Antibody
TA308761 100 µL

MCM3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human PPP1R2P1 Protein
E30P7181 20 µg

Recombinant Human PPP1R2P1 Protein

Sign In for Pricing
View Details