Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nucleophosmin/Npm1, Human (193a.a, His)

The nucleophosmin/Npm1 protein plays critical roles in ribosome biogenesis, centrosome duplication, protein chaperones, histone assembly, and cell proliferation. Npm1 is a key player in the cellular orchestra that promotes ribosome nuclear export, associates with nucleolar ribonucleoprotein structures, and interacts with single-stranded nucleic acids. Nucleophosmin/Npm1 Protein, Human (193a.a, His) is the recombinant human-derived Nucleophosmin/Npm1 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

Nucleophosmin/Npm1 Protein, Human (193a.a, His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nucleophosmin-npm1-protein-human-his.html

Purity

96.00

Smiles

EDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL

Molecular Formula

4869 (Gene_ID) P06748-1 (E2-L294) (Accession)

Molecular Weight

Approximately 35 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal CD5L Antibody [DyLight 550]
NBP1-76699R 0.1 mL

Rabbit Polyclonal CD5L Antibody [DyLight 550]

Sign In for Pricing
View Details
Lyrm2 Rat shRNA Plasmid (Locus ID 690354)
TR708306 1 Kit

Lyrm2 Rat shRNA Plasmid (Locus ID 690354)

Sign In for Pricing
View Details
CAMKK2 Protein Vector (Mouse) (pPM-C-HA)
PV161264 500 ng

CAMKK2 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
CENPN, CT (CENPN, C16orf60, ICEN32, Centromere protein N, Interphase centromere complex protein 32) (MaxLight 405) discontinued
033771-ML405 100 µL

CENPN, CT (CENPN, C16orf60, ICEN32, Centromere protein N, Interphase centromere complex protein 32) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Human CRYBA4 Protein Lysate
MBS139942-01 0.02 mg

Human CRYBA4 Protein Lysate

Sign In for Pricing
View Details
Human CRYBA4 Protein Lysate
MBS139942-02 5x 0.02 mg

Human CRYBA4 Protein Lysate

Sign In for Pricing
View Details