Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nucleophosmin/Npm1, Human (193a.a, His)

The nucleophosmin/Npm1 protein plays critical roles in ribosome biogenesis, centrosome duplication, protein chaperones, histone assembly, and cell proliferation. Npm1 is a key player in the cellular orchestra that promotes ribosome nuclear export, associates with nucleolar ribonucleoprotein structures, and interacts with single-stranded nucleic acids. Nucleophosmin/Npm1 Protein, Human (193a.a, His) is the recombinant human-derived Nucleophosmin/Npm1 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

Nucleophosmin/Npm1 Protein, Human (193a.a, His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nucleophosmin-npm1-protein-human-his.html

Purity

96.00

Smiles

EDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL

Molecular Formula

4869 (Gene_ID) P06748-1 (E2-L294) (Accession)

Molecular Weight

Approximately 35 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF324 Protein Vector (Human) (pPB-C-His)
PV047669 500 ng

ZNF324 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Anti-Salivary alpha amylase Rabbit pAb
GB112405 100 μL

Anti-Salivary alpha amylase Rabbit pAb

Sign In for Pricing
View Details
Ccdc129 3'UTR Luciferase Stable Cell Line
TU103245 1.0 mL

Ccdc129 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Anti-LXR alpha (Recombinant Rabbit, Monoclonal, IgG)
A115956 100 µL

Anti-LXR alpha (Recombinant Rabbit, Monoclonal, IgG)

Sign In for Pricing
View Details
FRA12B sgRNA CRISPR Lentivector (Human) (Target 3)
K0808904 1.0 µg DNA

FRA12B sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Arglu1 (NM_176849) Mouse Tagged ORF Clone
MG217165 10 µg

Arglu1 (NM_176849) Mouse Tagged ORF Clone

Sign In for Pricing
View Details