Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nucleophosmin/Npm1, Human (193a.a, His)

The nucleophosmin/Npm1 protein plays critical roles in ribosome biogenesis, centrosome duplication, protein chaperones, histone assembly, and cell proliferation. Npm1 is a key player in the cellular orchestra that promotes ribosome nuclear export, associates with nucleolar ribonucleoprotein structures, and interacts with single-stranded nucleic acids. Nucleophosmin/Npm1 Protein, Human (193a.a, His) is the recombinant human-derived Nucleophosmin/Npm1 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

Nucleophosmin/Npm1 Protein, Human (193a.a, His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nucleophosmin-npm1-protein-human-his.html

Purity

96.00

Smiles

EDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL

Molecular Formula

4869 (Gene_ID) P06748-1 (E2-L294) (Accession)

Molecular Weight

Approximately 35 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Red Blood Cells
MBS539332-01 25 mL

Rat Red Blood Cells

Sign In for Pricing
View Details
Rat Red Blood Cells
MBS539332-02 5x 25 mL

Rat Red Blood Cells

Sign In for Pricing
View Details
Grasp sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4567106 1.0 µg DNA

Grasp sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Olr260 sgRNA CRISPR Lentivector (Rat) (Target 3)
K7302204 1.0 µg DNA

Olr260 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
RAB14 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
38300156 3x 1.0 µg DNA

RAB14 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
Clorgyline hydrochloride 25mg
A17357-25 25 mg

Clorgyline hydrochloride 25mg

Sign In for Pricing
View Details