Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nucleophosmin/Npm1, Human (193a.a, His)

The nucleophosmin/Npm1 protein plays critical roles in ribosome biogenesis, centrosome duplication, protein chaperones, histone assembly, and cell proliferation. Npm1 is a key player in the cellular orchestra that promotes ribosome nuclear export, associates with nucleolar ribonucleoprotein structures, and interacts with single-stranded nucleic acids. Nucleophosmin/Npm1 Protein, Human (193a.a, His) is the recombinant human-derived Nucleophosmin/Npm1 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

Nucleophosmin/Npm1 Protein, Human (193a.a, His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nucleophosmin-npm1-protein-human-his.html

Purity

96.00

Smiles

EDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL

Molecular Formula

4869 (Gene_ID) P06748-1 (E2-L294) (Accession)

Molecular Weight

Approximately 35 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SAPK4 (MAPK13) Mouse Monoclonal Antibody [Clone ID: OTI2G1]
TA505852S 30 µL

SAPK4 (MAPK13) Mouse Monoclonal Antibody [Clone ID: OTI2G1]

Sign In for Pricing
View Details
Lentiviral mouse Arl15 shRNA (UAS) - Lentiviral mouse Arl15 shRNA (UAS, RFP) plasmid
GTR15264541 1 Vial

Lentiviral mouse Arl15 shRNA (UAS) - Lentiviral mouse Arl15 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Mouse Wnt16 qPCR Primer Pair
QM47586S 200 Tests

Mouse Wnt16 qPCR Primer Pair

Sign In for Pricing
View Details
CUX2 (cut-like Homeobox 2, CDP2, CUTL2) (APC)
245093-APC 100 µL

CUX2 (cut-like Homeobox 2, CDP2, CUTL2) (APC)

Sign In for Pricing
View Details
Acid Phosphatase (ACP) Assay Kit
abx294068 96 Tests

Acid Phosphatase (ACP) Assay Kit

Sign In for Pricing
View Details
GADD45GIP1 (Growth Arrest and DNA-damage-inducible Proteins-interacting Protein 1, PRG6, CRIF1, PLINP, CKBBP2, Plinp1, MRP-L59, PLINP-1, CKbetaBP2) (PE)
MBS6418047-01 0.1 mL

GADD45GIP1 (Growth Arrest and DNA-damage-inducible Proteins-interacting Protein 1, PRG6, CRIF1, PLINP, CKBBP2, Plinp1, MRP-L59, PLINP-1, CKbetaBP2) (PE)

Sign In for Pricing
View Details