Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nucleophosmin/Npm1, Human (193a.a, His)

The nucleophosmin/Npm1 protein plays critical roles in ribosome biogenesis, centrosome duplication, protein chaperones, histone assembly, and cell proliferation. Npm1 is a key player in the cellular orchestra that promotes ribosome nuclear export, associates with nucleolar ribonucleoprotein structures, and interacts with single-stranded nucleic acids. Nucleophosmin/Npm1 Protein, Human (193a.a, His) is the recombinant human-derived Nucleophosmin/Npm1 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

Nucleophosmin/Npm1 Protein, Human (193a.a, His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nucleophosmin-npm1-protein-human-his.html

Purity

96.00

Smiles

EDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL

Molecular Formula

4869 (Gene_ID) P06748-1 (E2-L294) (Accession)

Molecular Weight

Approximately 35 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Opn3 qPCR Primer Pair
QM12442S 200 Tests

Mouse Opn3 qPCR Primer Pair

Sign In for Pricing
View Details
ARX Recombinant Protein (Mouse)
RP117395 100 µg

ARX Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Plcd3 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4662203 1.0 µg DNA

Plcd3 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
SLC35E2 Protein Vector (Human) (pPB-N-His)
PV057962 500 ng

SLC35E2 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Human SDSL Pre-designed siRNA Set A
SI014439A 1 Each

Human SDSL Pre-designed siRNA Set A

Sign In for Pricing
View Details
Mouse Aadacl4fm1 activation kit by CRISPRa
GA217137 1 Kit

Mouse Aadacl4fm1 activation kit by CRISPRa

Sign In for Pricing
View Details