Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nucleophosmin/Npm1, Human (193a.a, His)

The nucleophosmin/Npm1 protein plays critical roles in ribosome biogenesis, centrosome duplication, protein chaperones, histone assembly, and cell proliferation. Npm1 is a key player in the cellular orchestra that promotes ribosome nuclear export, associates with nucleolar ribonucleoprotein structures, and interacts with single-stranded nucleic acids. Nucleophosmin/Npm1 Protein, Human (193a.a, His) is the recombinant human-derived Nucleophosmin/Npm1 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

Nucleophosmin/Npm1 Protein, Human (193a.a, His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nucleophosmin-npm1-protein-human-his.html

Purity

96.00

Smiles

EDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL

Molecular Formula

4869 (Gene_ID) P06748-1 (E2-L294) (Accession)

Molecular Weight

Approximately 35 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

COPZ2 (NM_016429) Human Over-expression Lysate
LY414016 100 µg

COPZ2 (NM_016429) Human Over-expression Lysate

Sign In for Pricing
View Details
Proline rich protein 26 (PRR26) Human shRNA Plasmid Kit (Locus ID 414235)
TL314407 1 Kit

Proline rich protein 26 (PRR26) Human shRNA Plasmid Kit (Locus ID 414235)

Sign In for Pricing
View Details
Apol8 (NM_001081970) Mouse Tagged ORF Clone Lentiviral Particle
MR225970L4V 200 µL

Apol8 (NM_001081970) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
LOC688539 Protein Vector (Rat) (pPM-C-His)
PV279397 500 ng

LOC688539 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Human Contactin Associated Protein Like Protein 2 (CNTNAP2) ELISA Kit
QY-E02799 96 Tests

Human Contactin Associated Protein Like Protein 2 (CNTNAP2) ELISA Kit

Sign In for Pricing
View Details
hsa-miR-3622a-5p Primers
MPH01483 150 µL / 10 µM

hsa-miR-3622a-5p Primers

Sign In for Pricing
View Details