Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nucleophosmin/Npm1, Human (193a.a, His)

The nucleophosmin/Npm1 protein plays critical roles in ribosome biogenesis, centrosome duplication, protein chaperones, histone assembly, and cell proliferation. Npm1 is a key player in the cellular orchestra that promotes ribosome nuclear export, associates with nucleolar ribonucleoprotein structures, and interacts with single-stranded nucleic acids. Nucleophosmin/Npm1 Protein, Human (193a.a, His) is the recombinant human-derived Nucleophosmin/Npm1 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

Nucleophosmin/Npm1 Protein, Human (193a.a, His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nucleophosmin-npm1-protein-human-his.html

Purity

96.00

Smiles

EDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL

Molecular Formula

4869 (Gene_ID) P06748-1 (E2-L294) (Accession)

Molecular Weight

Approximately 35 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rhox4c (NM_001039689) Mouse Tagged ORF Clone
MR221238 10 µg

Rhox4c (NM_001039689) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
SLAIN1 CRISPRa sgRNA lentivector (set of three targets)(Human)
43852121 3x 1.0µg DNA

SLAIN1 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Lentiviral mouse Sirt5 shRNA (UAS) - Lentiviral mouse Sirt5 shRNA (UAS, RFP) (25)
GTR15278591 1 Vial

Lentiviral mouse Sirt5 shRNA (UAS) - Lentiviral mouse Sirt5 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Mouse Ndufa12 activation kit by CRISPRa
GA206766 1 Kit

Mouse Ndufa12 activation kit by CRISPRa

Sign In for Pricing
View Details
NEK6 Recombinant Antibody, AbBy Fluor™ 647 Conjugated
bsm-62096R-BF647 100 µL

NEK6 Recombinant Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
Lentiviral mouse Skint1 shRNA (UAS) - Lentiviral mouse Skint1 shRNA (UAS, RFP) plasmid
GTR15301480 1 Vial

Lentiviral mouse Skint1 shRNA (UAS) - Lentiviral mouse Skint1 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details