Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nucleophosmin/Npm1, Human (193a.a, His)

The nucleophosmin/Npm1 protein plays critical roles in ribosome biogenesis, centrosome duplication, protein chaperones, histone assembly, and cell proliferation. Npm1 is a key player in the cellular orchestra that promotes ribosome nuclear export, associates with nucleolar ribonucleoprotein structures, and interacts with single-stranded nucleic acids. Nucleophosmin/Npm1 Protein, Human (193a.a, His) is the recombinant human-derived Nucleophosmin/Npm1 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

Nucleophosmin/Npm1 Protein, Human (193a.a, His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nucleophosmin-npm1-protein-human-his.html

Purity

96.00

Smiles

EDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL

Molecular Formula

4869 (Gene_ID) P06748-1 (E2-L294) (Accession)

Molecular Weight

Approximately 35 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human FMO5 shRNA (UAS) - Lentiviral human FMO5 shRNA (UAS, RFP) (25)
GTR15307058 1 Vial

Lentiviral human FMO5 shRNA (UAS) - Lentiviral human FMO5 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
C10orf131 Recombinant Protein Antigen
NBP2-58030PEP 100 µL

C10orf131 Recombinant Protein Antigen

Sign In for Pricing
View Details
Carcinoembryonic Antigen (CEA) (AP) discontinued
C1299-87P-AP 100 µL

Carcinoembryonic Antigen (CEA) (AP) discontinued

Sign In for Pricing
View Details
NXF2 (NM_017809) Human Tagged ORF Clone
RG217018 10 µg

NXF2 (NM_017809) Human Tagged ORF Clone

Sign In for Pricing
View Details
TTDN1 (MPLKIP) Human qPCR Primer Pair (NM_138701)
HP217039 200 Reactions

TTDN1 (MPLKIP) Human qPCR Primer Pair (NM_138701)

Sign In for Pricing
View Details
Rabbit Polyclonal NLRX1 Antibody
NBP2-27198SS 0.025 mg

Rabbit Polyclonal NLRX1 Antibody

Sign In for Pricing
View Details