Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nucleophosmin/Npm1, Human (193a.a, His)

The nucleophosmin/Npm1 protein plays critical roles in ribosome biogenesis, centrosome duplication, protein chaperones, histone assembly, and cell proliferation. Npm1 is a key player in the cellular orchestra that promotes ribosome nuclear export, associates with nucleolar ribonucleoprotein structures, and interacts with single-stranded nucleic acids. Nucleophosmin/Npm1 Protein, Human (193a.a, His) is the recombinant human-derived Nucleophosmin/Npm1 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

Nucleophosmin/Npm1 Protein, Human (193a.a, His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nucleophosmin-npm1-protein-human-his.html

Purity

96.00

Smiles

EDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL

Molecular Formula

4869 (Gene_ID) P06748-1 (E2-L294) (Accession)

Molecular Weight

Approximately 35 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

20 x Synovial Fluid Solution
GR103059 100 mL

20 x Synovial Fluid Solution

Sign In for Pricing
View Details
Recombinant Human Cysteine And Glycine Rich Protein 1 (CSRP1)
RPU51874-01 50 µg

Recombinant Human Cysteine And Glycine Rich Protein 1 (CSRP1)

Sign In for Pricing
View Details
Recombinant Human Cysteine And Glycine Rich Protein 1 (CSRP1)
RPU51874-02 100 µg

Recombinant Human Cysteine And Glycine Rich Protein 1 (CSRP1)

Sign In for Pricing
View Details
Recombinant Human Cysteine And Glycine Rich Protein 1 (CSRP1)
RPU51874-03 1 mg

Recombinant Human Cysteine And Glycine Rich Protein 1 (CSRP1)

Sign In for Pricing
View Details
Lentiviral human GABPB2 shRNA (UAS) - Lentiviral human GABPB2 shRNA (UAS) (100)
GTR15101766 1 Vial

Lentiviral human GABPB2 shRNA (UAS) - Lentiviral human GABPB2 shRNA (UAS) (100)

Sign In for Pricing
View Details
TGX 221 10 mg
5832/10 10 mg

TGX 221 10 mg

Sign In for Pricing
View Details