Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nucleophosmin/Npm1, Human (193a.a, His)

The nucleophosmin/Npm1 protein plays critical roles in ribosome biogenesis, centrosome duplication, protein chaperones, histone assembly, and cell proliferation. Npm1 is a key player in the cellular orchestra that promotes ribosome nuclear export, associates with nucleolar ribonucleoprotein structures, and interacts with single-stranded nucleic acids. Nucleophosmin/Npm1 Protein, Human (193a.a, His) is the recombinant human-derived Nucleophosmin/Npm1 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

Nucleophosmin/Npm1 Protein, Human (193a.a, His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nucleophosmin-npm1-protein-human-his.html

Purity

96.00

Smiles

EDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL

Molecular Formula

4869 (Gene_ID) P06748-1 (E2-L294) (Accession)

Molecular Weight

Approximately 35 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Entpd5 shRNA (UAS) - Lentiviral mouse Entpd5 shRNA (UAS, GFP) plasmid
GTR15286966 1 Vial

Lentiviral mouse Entpd5 shRNA (UAS) - Lentiviral mouse Entpd5 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Human Thrombospondin-2 ELISA kit
LF-EK50605 1×96T

Human Thrombospondin-2 ELISA kit

Sign In for Pricing
View Details
Human Diamine Oxidase (DAO) ELISA Kit
NSL2141Hu 96 Tests

Human Diamine Oxidase (DAO) ELISA Kit

Sign In for Pricing
View Details
PPAT sgRNA CRISPR Lentivector (Human) (Target 2)
K1694003 1.0 µg DNA

PPAT sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
InVivoMAb Anti-HRSV F/Fusion glycoprotein F0 Antibody (RSV19)
MBS1579912-01 0.1 mg

InVivoMAb Anti-HRSV F/Fusion glycoprotein F0 Antibody (RSV19)

Sign In for Pricing
View Details
InVivoMAb Anti-HRSV F/Fusion glycoprotein F0 Antibody (RSV19)
MBS1579912-02 1 mg

InVivoMAb Anti-HRSV F/Fusion glycoprotein F0 Antibody (RSV19)

Sign In for Pricing
View Details