Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nucleophosmin/Npm1, Human (193a.a, His)

The nucleophosmin/Npm1 protein plays critical roles in ribosome biogenesis, centrosome duplication, protein chaperones, histone assembly, and cell proliferation. Npm1 is a key player in the cellular orchestra that promotes ribosome nuclear export, associates with nucleolar ribonucleoprotein structures, and interacts with single-stranded nucleic acids. Nucleophosmin/Npm1 Protein, Human (193a.a, His) is the recombinant human-derived Nucleophosmin/Npm1 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

Nucleophosmin/Npm1 Protein, Human (193a.a, His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nucleophosmin-npm1-protein-human-his.html

Purity

96.00

Smiles

EDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL

Molecular Formula

4869 (Gene_ID) P06748-1 (E2-L294) (Accession)

Molecular Weight

Approximately 35 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MIR7070 Mouse qPCR Template Standard (MI0022920)
MK301056 200 Reactions

MIR7070 Mouse qPCR Template Standard (MI0022920)

Sign In for Pricing
View Details
CLPP Antibody
C48035-01 50 μL

CLPP Antibody

Sign In for Pricing
View Details
CLPP Antibody
C48035-02 100 µL

CLPP Antibody

Sign In for Pricing
View Details
H2AFY2 ORF Vector (Human) (pORF)
ORF004777 1.0 µg DNA

H2AFY2 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Hinfp sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4488902 1.0 µg DNA

Hinfp sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Uvrag (NM_178635) Mouse Tagged ORF Clone
MR210112 10 µg

Uvrag (NM_178635) Mouse Tagged ORF Clone

Sign In for Pricing
View Details