Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nucleophosmin/Npm1, Human (193a.a, His)

The nucleophosmin/Npm1 protein plays critical roles in ribosome biogenesis, centrosome duplication, protein chaperones, histone assembly, and cell proliferation. Npm1 is a key player in the cellular orchestra that promotes ribosome nuclear export, associates with nucleolar ribonucleoprotein structures, and interacts with single-stranded nucleic acids. Nucleophosmin/Npm1 Protein, Human (193a.a, His) is the recombinant human-derived Nucleophosmin/Npm1 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

Nucleophosmin/Npm1 Protein, Human (193a.a, His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nucleophosmin-npm1-protein-human-his.html

Purity

96.00

Smiles

EDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL

Molecular Formula

4869 (Gene_ID) P06748-1 (E2-L294) (Accession)

Molecular Weight

Approximately 35 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NPAS4 Rabbit Polyclonal Antibody
TA316290 100 µL

NPAS4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NR1I3 (CAR, Nuclear Receptor Subfamily 1 Group I Member 3, Constitutive Activator of Retinoid Response, Constitutive Androstane Receptor, Orphan Nuclear Receptor MB67) (MaxLight 405) discontinued
130540-ML405 100 µL

NR1I3 (CAR, Nuclear Receptor Subfamily 1 Group I Member 3, Constitutive Activator of Retinoid Response, Constitutive Androstane Receptor, Orphan Nuclear Receptor MB67) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O6:K15:H31 (strain 536/UPEC) STHA Polyclonal Antibody
MBS7187765 Inquire

Rabbit anti-Escherichia coli O6:K15:H31 (strain 536/UPEC) STHA Polyclonal Antibody

Sign In for Pricing
View Details
SH3BGRL2 Protein Vector (Human) (pPB-C-His)
PV057701 500 ng

SH3BGRL2 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
SFTA2 Protein Vector (Human) (pPM-C-HA)
PV128904 500 ng

SFTA2 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Rabbit Monoclonal PD-1 Antibody (PDCD1/7276R) [DyLight 550]
NBP3-20952R 0.1 mL

Rabbit Monoclonal PD-1 Antibody (PDCD1/7276R) [DyLight 550]

Sign In for Pricing
View Details