Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nucleophosmin/Npm1, Human (193a.a, His)

The nucleophosmin/Npm1 protein plays critical roles in ribosome biogenesis, centrosome duplication, protein chaperones, histone assembly, and cell proliferation. Npm1 is a key player in the cellular orchestra that promotes ribosome nuclear export, associates with nucleolar ribonucleoprotein structures, and interacts with single-stranded nucleic acids. Nucleophosmin/Npm1 Protein, Human (193a.a, His) is the recombinant human-derived Nucleophosmin/Npm1 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

Nucleophosmin/Npm1 Protein, Human (193a.a, His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nucleophosmin-npm1-protein-human-his.html

Purity

96.00

Smiles

EDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL

Molecular Formula

4869 (Gene_ID) P06748-1 (E2-L294) (Accession)

Molecular Weight

Approximately 35 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RBM41, CT (RBM41, RNA-binding protein 41, RNA-binding motif protein 41) (MaxLight 550)
MBS6340791-01 0.1 mL

RBM41, CT (RBM41, RNA-binding protein 41, RNA-binding motif protein 41) (MaxLight 550)

Sign In for Pricing
View Details
RBM41, CT (RBM41, RNA-binding protein 41, RNA-binding motif protein 41) (MaxLight 550)
MBS6340791-02 5x 0.1 mL

RBM41, CT (RBM41, RNA-binding protein 41, RNA-binding motif protein 41) (MaxLight 550)

Sign In for Pricing
View Details
EPX sgRNA CRISPR Lentivector (Human) (Target 3)
K0689804 1.0 µg DNA

EPX sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Cyclin B1 (CCNB1) (NM_031966) Human Tagged Lenti ORF Clone
RC200812L1 10 µg

Cyclin B1 (CCNB1) (NM_031966) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
P21 Waf1/Cip1 siRNA (r)
sc-108036 10 µM

P21 Waf1/Cip1 siRNA (r)

Sign In for Pricing
View Details
Sdr16c5 ORF Vector (Rat) (pORF)
43269016 1.0 µg DNA

Sdr16c5 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details