Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nucleophosmin/Npm1, Human (193a.a, His)

The nucleophosmin/Npm1 protein plays critical roles in ribosome biogenesis, centrosome duplication, protein chaperones, histone assembly, and cell proliferation. Npm1 is a key player in the cellular orchestra that promotes ribosome nuclear export, associates with nucleolar ribonucleoprotein structures, and interacts with single-stranded nucleic acids. Nucleophosmin/Npm1 Protein, Human (193a.a, His) is the recombinant human-derived Nucleophosmin/Npm1 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

Nucleophosmin/Npm1 Protein, Human (193a.a, His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nucleophosmin-npm1-protein-human-his.html

Purity

96.00

Smiles

EDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL

Molecular Formula

4869 (Gene_ID) P06748-1 (E2-L294) (Accession)

Molecular Weight

Approximately 35 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vmn2r65 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3143907 1.0 µg DNA

Vmn2r65 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Phospho-FANCG (Ser383) Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-5353R-BF647 100 µL

Phospho-FANCG (Ser383) Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
Rat Bone Marrow Immature Dendritic Cell Complete Medium
CM-R162A-01 100 mL

Rat Bone Marrow Immature Dendritic Cell Complete Medium

Sign In for Pricing
View Details
Rat Bone Marrow Immature Dendritic Cell Complete Medium
CM-R162A-02 4x 125 mL

Rat Bone Marrow Immature Dendritic Cell Complete Medium

Sign In for Pricing
View Details
c-Myc (phospho Thr58) Polyclonal Antibody
UB-GEN-1203 100 µL

c-Myc (phospho Thr58) Polyclonal Antibody

Sign In for Pricing
View Details
GOLGA7 Rabbit pAb
MBS8549668-01 0.1 mL

GOLGA7 Rabbit pAb

Sign In for Pricing
View Details