Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nucleophosmin/Npm1, Human (193a.a, His)

The nucleophosmin/Npm1 protein plays critical roles in ribosome biogenesis, centrosome duplication, protein chaperones, histone assembly, and cell proliferation. Npm1 is a key player in the cellular orchestra that promotes ribosome nuclear export, associates with nucleolar ribonucleoprotein structures, and interacts with single-stranded nucleic acids. Nucleophosmin/Npm1 Protein, Human (193a.a, His) is the recombinant human-derived Nucleophosmin/Npm1 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

Nucleophosmin/Npm1 Protein, Human (193a.a, His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nucleophosmin-npm1-protein-human-his.html

Purity

96.00

Smiles

EDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL

Molecular Formula

4869 (Gene_ID) P06748-1 (E2-L294) (Accession)

Molecular Weight

Approximately 35 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

D-Luciferin potassium salt
GC208039-100mg 100 mg

D-Luciferin potassium salt

Sign In for Pricing
View Details
Irbesartan (Avapro) 200mg
A10477-200 200 mg

Irbesartan (Avapro) 200mg

Sign In for Pricing
View Details
Lentiviral mouse Mrpl51 shRNA (UAS) - Lentiviral mouseMrpl51 shRNA (UAS, GFP) (25)
GTR15119144 1 Vial

Lentiviral mouse Mrpl51 shRNA (UAS) - Lentiviral mouseMrpl51 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Rhobtb3 Rat shRNA Lentiviral Particle (Locus ID 309922)
TL706198V 500 µL Each

Rhobtb3 Rat shRNA Lentiviral Particle (Locus ID 309922)

Sign In for Pricing
View Details
Ankfy1 Rat shRNA Plasmid (Locus ID 303292)
TR705590 1 Kit

Ankfy1 Rat shRNA Plasmid (Locus ID 303292)

Sign In for Pricing
View Details
Preschisanartanin B
HY-N1539 1 Each

Preschisanartanin B

Sign In for Pricing
View Details