Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nucleophosmin/Npm1, Human (193a.a, His)

The nucleophosmin/Npm1 protein plays critical roles in ribosome biogenesis, centrosome duplication, protein chaperones, histone assembly, and cell proliferation. Npm1 is a key player in the cellular orchestra that promotes ribosome nuclear export, associates with nucleolar ribonucleoprotein structures, and interacts with single-stranded nucleic acids. Nucleophosmin/Npm1 Protein, Human (193a.a, His) is the recombinant human-derived Nucleophosmin/Npm1 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

Nucleophosmin/Npm1 Protein, Human (193a.a, His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nucleophosmin-npm1-protein-human-his.html

Purity

96.00

Smiles

EDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL

Molecular Formula

4869 (Gene_ID) P06748-1 (E2-L294) (Accession)

Molecular Weight

Approximately 35 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-DDX41 antibody
STJ28659 100 µl

Anti-DDX41 antibody

Sign In for Pricing
View Details
TADA1L (TADA1) Human qPCR Template Standard (NM_053053)
HK207193 1 Kit

TADA1L (TADA1) Human qPCR Template Standard (NM_053053)

Sign In for Pricing
View Details
Trap1a CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
47510154 3x 1.0 µg DNA

Trap1a CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
CDT2 Rabbit mAb
MBS9468549-01 0.05 mL

CDT2 Rabbit mAb

Sign In for Pricing
View Details
CDT2 Rabbit mAb
MBS9468549-02 0.1 mL

CDT2 Rabbit mAb

Sign In for Pricing
View Details
CDT2 Rabbit mAb
MBS9468549-03 5x 0.1 mL

CDT2 Rabbit mAb

Sign In for Pricing
View Details