Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nucleophosmin/Npm1, Human (193a.a, His)

The nucleophosmin/Npm1 protein plays critical roles in ribosome biogenesis, centrosome duplication, protein chaperones, histone assembly, and cell proliferation. Npm1 is a key player in the cellular orchestra that promotes ribosome nuclear export, associates with nucleolar ribonucleoprotein structures, and interacts with single-stranded nucleic acids. Nucleophosmin/Npm1 Protein, Human (193a.a, His) is the recombinant human-derived Nucleophosmin/Npm1 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

Nucleophosmin/Npm1 Protein, Human (193a.a, His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nucleophosmin-npm1-protein-human-his.html

Purity

96.00

Smiles

EDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL

Molecular Formula

4869 (Gene_ID) P06748-1 (E2-L294) (Accession)

Molecular Weight

Approximately 35 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRKACB CRISPRa sgRNA lentivector (set of three targets)(Rat)
37625126 3x 1.0µg DNA

PRKACB CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
Lentiviral mouse Kbtbd4 shRNA (UAS) - Lentiviral mouseKbtbd4 shRNA (UAS, GFP) (25)
GTR15182636 1 Vial

Lentiviral mouse Kbtbd4 shRNA (UAS) - Lentiviral mouseKbtbd4 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
TBC1D9B (NM_015043) Human Over-expression Lysate
LH09473V 100 µg

TBC1D9B (NM_015043) Human Over-expression Lysate

Sign In for Pricing
View Details
Rabbit anti-TAOK1 Antibody, Affinity Purified
MBS3901088-01 0.01 mg

Rabbit anti-TAOK1 Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-TAOK1 Antibody, Affinity Purified
MBS3901088-02 0.1 mg

Rabbit anti-TAOK1 Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-TAOK1 Antibody, Affinity Purified
MBS3901088-03 5x 0.01 mg

Rabbit anti-TAOK1 Antibody, Affinity Purified

Sign In for Pricing
View Details