TFPI2, Human (HEK293, His)
The critical role of the TFPI2 protein in regulating plasmin-mediated matrix remodeling suggests its involvement in extracellular matrix dynamics. It inhibits trypsin, plasmin, factor VIIa/tissue factor and weak factor Xa, affecting coagulation and fibrinolysis. TFPI2 Protein, Human (HEK293, His) is the recombinant human-derived TFPI2 protein, expressed by HEK293 , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
TFPI2 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/tfpi-2-protein-human-hek-293-his.html
Purity
95.0
Smiles
DAAQEPTGNNAEICLLPLDYGPCRALLLRYYYDRYTQSCRQFLYGGCEGNANNFYTWEACDDACWRIEKVPKVCRLQVSVDDQCEGSTEKYFFNLSSMTCEKFFSGGCHRNRIENRFPDEATCMGFCAPKKIPSFCYSPKDEGLCSANVTRYYFNPRYRTCDAFTYTGCGGNDNNFVSREDCKRACAKALK
Molecular Formula
7980 (Gene_ID) P48307 (D23-K213) (Accession)
Molecular Weight
18-33 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680525-100 1x 100 µL
CD63 (MX-49.129.5), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880178-500 1x 500 µL
CD50 (ICAM-3) (186-2G9), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400146-500 1x 500 µL
CD10 (CB-CALLA), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040146-500 1x 500 µL
CD10 (CB-CALLA), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details