Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TFPI2, Human (HEK293, His)

The critical role of the TFPI2 protein in regulating plasmin-mediated matrix remodeling suggests its involvement in extracellular matrix dynamics. It inhibits trypsin, plasmin, factor VIIa/tissue factor and weak factor Xa, affecting coagulation and fibrinolysis. TFPI2 Protein, Human (HEK293, His) is the recombinant human-derived TFPI2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

TFPI2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tfpi-2-protein-human-hek-293-his.html

Purity

95.0

Smiles

DAAQEPTGNNAEICLLPLDYGPCRALLLRYYYDRYTQSCRQFLYGGCEGNANNFYTWEACDDACWRIEKVPKVCRLQVSVDDQCEGSTEKYFFNLSSMTCEKFFSGGCHRNRIENRFPDEATCMGFCAPKKIPSFCYSPKDEGLCSANVTRYYFNPRYRTCDAFTYTGCGGNDNNFVSREDCKRACAKALK

Molecular Formula

7980 (Gene_ID) P48307 (D23-K213) (Accession)

Molecular Weight

18-33 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tensin 1 (aa902-914)
551565 100 µg

Tensin 1 (aa902-914)

Sign In for Pricing
View Details
Lindemann Orchid Medium w/ Vitamins & Sucrose; w/o Agar
PT 1067-01 5 L

Lindemann Orchid Medium w/ Vitamins & Sucrose; w/o Agar

Sign In for Pricing
View Details
Lindemann Orchid Medium w/ Vitamins & Sucrose; w/o Agar
PT 1067-02 10x 1 L

Lindemann Orchid Medium w/ Vitamins & Sucrose; w/o Agar

Sign In for Pricing
View Details
Lindemann Orchid Medium w/ Vitamins & Sucrose; w/o Agar
PT 1067-03 25 L

Lindemann Orchid Medium w/ Vitamins & Sucrose; w/o Agar

Sign In for Pricing
View Details
C5orf20 Polyclonal Antibody, PE-Cy5 Conjugated
bs-15199R-PE-Cy5 100 µL

C5orf20 Polyclonal Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details
Gadd45g sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3882504 1.0 µg DNA

Gadd45g sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details