EIF1AX, Human (His)
The EIF1AX protein is an important member of the 43S preinitiation complex (43S PIC) and is responsible for coordinating mRNA cap-proximal binding, scanning the 5'-untranslated region, and pinpointing the start codon. EIF1AX Protein, Human (His) is the recombinant human-derived EIF1AX protein, expressed by E. coli , with N-6*His labeled tag.
Product Specifications
Product Name Alternative
EIF1AX Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/eif1ax-protein-human-his.html
Smiles
MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDEDIDDI
Molecular Formula
1964 (Gene_ID) P47813 (M1-I144) (Accession)
Molecular Weight
Approximately 22 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
1,2-Dimethyl-3-propylimidazolium bis (trifluoromethylsulfonyl) imide
MCC (Colorectal Mutant Cancer Protein, Protein MCC, Mutated In Colorectal Cancers, MCC1, FLJ38893, FLJ46755, DKFZp762O1615) (AP)
