Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fetuin A/AHSG, Human (HEK293, His)

Fetuin A (or AHSG protein) plays multiple roles in cellular processes, promotes endocytosis and displays opsonic properties. It regulates the mineral phase of bone, affects bone homeostasis, and has significant affinity for calcium and barium ions. Fetuin A/AHSG Protein, Human (HEK293, His) is the recombinant human-derived Fetuin A/AHSG protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Fetuin A/AHSG Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fetuin-a-ahsg-protein-human-hek-293-his.html

Purity

95.0

Smiles

APHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTLNQIDEVKVWPQQPSGELFEIEIDTLETTCHVLDPTPVARCSVRQLKEHAVEGDCDFQLLKLDGKFSVVYAKCDSSPDSAEDVRKVCQDCPLLAPLNDTRVVHAAKAALAAFNAQNNGSNFQLEEISRAQLVPLPPSTYVEFTVSGTDCVAKEATEAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCTVFQTQPVTSQPQPEGANEAVPTPVVDPDAPPSPPLGAPGLPPAGSPPDSHVLLAAPPGHQLHRAHYDLRHTFMGVVSLGSPSGEVSHPRKTRTVVQPSVGAAAGPVVPPCPGRIRHFKV

Molecular Formula

197 (Gene_ID) AAH48198.1/NP_001613.2 (A19-V367) (Accession)

Molecular Weight

Approximately 60.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD59 (heavy chain of Protectin) (BRA-10G), CF647 conjugate, 0.1mg/mL
BNC470181-500 1x 500 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (SX53G8), CF647 conjugate, 0.1mg/mL
BNC470669-500 1x 500 µL

P27 / KIP1 (SX53G8), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF405S conjugate, 0.1mg/mL
BNC040525-100 1x 100 µL

CD63 (MX-49.129.5), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 (PAb122), CF568 conjugate, 0.1mg/mL
BNC680338-500 1x 500 µL

P53 (PAb122), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 10 (Suprabasal Epithelial Marker) (AE20), CF640R conjugate, 0.1mg/mL
BNC401274-500 1x 500 µL

Cytokeratin 10 (Suprabasal Epithelial Marker) (AE20), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (GP1.4), CF647 conjugate, 0.1mg/mL
BNC470159-100 1x 100 µL

Mucin 1 / EMA / Episialin / CD227 (GP1.4), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details