EGF, Mouse (HEK293, Fc)
EGF Protein, a growth factor, is essential for cell growth, proliferation, and differentiation. It binds to the EGF receptor, activating signaling pathways that regulate cell survival and tissue repair. EGF Protein has therapeutic potential in promoting wound healing, tissue regeneration, and cancer treatment. Its role in cellular processes makes it a subject of interest in biomedical research. EGF Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived EGF protein, expressed by HEK293 , with N-hFc labeled tag.
Product Specifications
Product Name Alternative
EGF Protein, Mouse (HEK293, Fc), Mouse, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/egf-protein-mouse-hek293-fc.html
Smiles
NSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR
Molecular Formula
13645 (Gene_ID) P01132 (N977-R1029) (Accession)
Molecular Weight
Approximately 44 kDa & 38, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Dry ice.
Scientific Category
Recombinant Proteins
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF594 conjugate, 0.1mg/mL
CD44 Standard (DF1485), CF568 conjugate, 0.1mg/mL
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/1887R), CF594 conjugate, 0.1mg/mL
GFAP (Astrocyte & Neural Stem Cell Marker) (ASTRO/1974R), CF568 conjugate, 0.1mg/mL
