Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SULT1A3, Human (His, solution)

SULT1A3 protein, a sulfotransferase utilizing PAPS, catalyzes the sulfate conjugation of phenolic monoamines, including neurotransmitters (dopamine, norepinephrine, serotonin) and drugs. This activity contributes significantly to inactivation and elimination, emphasizing SULT1A3's crucial role in regulating neurotransmitter and drug levels, maintaining homeostasis, and ensuring proper biological system functioning. SULT1A3 Protein, Human (His, solution) is the recombinant human-derived SULT1A3 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

SULT1A3 Protein, Human (His, solution), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sult1a3-protein-human-his.html

Purity

98.0

Smiles

MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLINTYPKSGTTWVSQILDMIYQGGDLEKCNRAPIYVRVPFLEVNDPGEPSGLETLKDTPPPRLIKSHLPLALLPQTLLDQKVKVVYVARNPKDVAVSYYHFHRMEKAHPEPGTWDSFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETMDFMVQHTSFKEMKKNPMTNYTTVPQELMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL

Molecular Formula

445329 (Gene_ID) P0DMM9-1 (M1-L295) (Accession)

Molecular Weight

Approximately 35.0 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

67kDa Laminin Receptor (RPSA) (NM_001012321) Human Over-expression Lysate
LC423324 20 µg

67kDa Laminin Receptor (RPSA) (NM_001012321) Human Over-expression Lysate

Sign In for Pricing
View Details
Vmn1r89 Mouse Gene Knockout Kit (CRISPR)
KN519106 1 Kit

Vmn1r89 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Rufloxacin Hydrochloride
TRC-R701570-25MG 25 mg

Rufloxacin Hydrochloride

Sign In for Pricing
View Details
Leucomycins (>85%)
TRC-L330320-5G 5 g

Leucomycins (>85%)

Sign In for Pricing
View Details
AP1M1 (Center) Rabbit Polyclonal Antibody
AP50198PU-N 400 µL

AP1M1 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
1,3-Benzodioxole-5-carbonyl Chloride
TRC-B276720-25MG 25 mg

1,3-Benzodioxole-5-carbonyl Chloride

Sign In for Pricing
View Details