Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SULT1A3, Human (His, solution)

SULT1A3 protein, a sulfotransferase utilizing PAPS, catalyzes the sulfate conjugation of phenolic monoamines, including neurotransmitters (dopamine, norepinephrine, serotonin) and drugs. This activity contributes significantly to inactivation and elimination, emphasizing SULT1A3's crucial role in regulating neurotransmitter and drug levels, maintaining homeostasis, and ensuring proper biological system functioning. SULT1A3 Protein, Human (His, solution) is the recombinant human-derived SULT1A3 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

SULT1A3 Protein, Human (His, solution), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sult1a3-protein-human-his.html

Purity

98.0

Smiles

MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLINTYPKSGTTWVSQILDMIYQGGDLEKCNRAPIYVRVPFLEVNDPGEPSGLETLKDTPPPRLIKSHLPLALLPQTLLDQKVKVVYVARNPKDVAVSYYHFHRMEKAHPEPGTWDSFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETMDFMVQHTSFKEMKKNPMTNYTTVPQELMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL

Molecular Formula

445329 (Gene_ID) P0DMM9-1 (M1-L295) (Accession)

Molecular Weight

Approximately 35.0 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Rat Ig Kappa light chain Antibody (HRP)
KH-2674-01 50 μL

Anti-Rat Ig Kappa light chain Antibody (HRP)

Sign In for Pricing
View Details
Anti-Rat Ig Kappa light chain Antibody (HRP)
KH-2674-02 100 µL

Anti-Rat Ig Kappa light chain Antibody (HRP)

Sign In for Pricing
View Details
Anti-Rat Ig Kappa light chain Antibody (HRP)
KH-2674-03 1 mL

Anti-Rat Ig Kappa light chain Antibody (HRP)

Sign In for Pricing
View Details
Nandrolone Hemisuccinate
TRC-N315035-10MG 10 mg

Nandrolone Hemisuccinate

Sign In for Pricing
View Details
3',5'-Di-p-toluate Thymidine-13C,15N2
TRC-D679417-50MG 50 mg

3',5'-Di-p-toluate Thymidine-13C,15N2

Sign In for Pricing
View Details
alpha Sarcoglycan (SGCA) (NM_000023) Human Recombinant Protein
TP306577M 100 µg

alpha Sarcoglycan (SGCA) (NM_000023) Human Recombinant Protein

Sign In for Pricing
View Details