Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SULT1A3, Human (His, solution)

SULT1A3 protein, a sulfotransferase utilizing PAPS, catalyzes the sulfate conjugation of phenolic monoamines, including neurotransmitters (dopamine, norepinephrine, serotonin) and drugs. This activity contributes significantly to inactivation and elimination, emphasizing SULT1A3's crucial role in regulating neurotransmitter and drug levels, maintaining homeostasis, and ensuring proper biological system functioning. SULT1A3 Protein, Human (His, solution) is the recombinant human-derived SULT1A3 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

SULT1A3 Protein, Human (His, solution), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sult1a3-protein-human-his.html

Purity

98.0

Smiles

MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLINTYPKSGTTWVSQILDMIYQGGDLEKCNRAPIYVRVPFLEVNDPGEPSGLETLKDTPPPRLIKSHLPLALLPQTLLDQKVKVVYVARNPKDVAVSYYHFHRMEKAHPEPGTWDSFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETMDFMVQHTSFKEMKKNPMTNYTTVPQELMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL

Molecular Formula

445329 (Gene_ID) P0DMM9-1 (M1-L295) (Accession)

Molecular Weight

Approximately 35.0 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NELL2 (NM_001145107) Human Over-expression Lysate
LY428694 100 µg

NELL2 (NM_001145107) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue Total RNA, Lung
CR560653 5 µg

Tissue Total RNA, Lung

Sign In for Pricing
View Details
Parecoxib Sodium
TRC-P193275-10MG 10 mg

Parecoxib Sodium

Sign In for Pricing
View Details
PDE4A Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1C8]
TA501192AM 100 µL

PDE4A Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1C8]

Sign In for Pricing
View Details
CD25/ IL2RA (Activated Lymphocyte Marker) (IL2RA/2395), CF647 conjugate, 0.1mg/mL
BNC472395-500 1x 500 µL

CD25/ IL2RA (Activated Lymphocyte Marker) (IL2RA/2395), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 20 (KRT20) (NM_019010) Human Over-expression Lysate
LY402725 100 µg

Cytokeratin 20 (KRT20) (NM_019010) Human Over-expression Lysate

Sign In for Pricing
View Details