Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prolactin, Mouse (His)

Prolactin Protein, acting on the mammary gland, plays a pivotal role in promoting lactation through interaction with its receptor, PRLR, facilitating the lactation process.Prolactin Protein, Mouse (His) is the recombinant mouse-derived Prolactin protein, expressed by E.coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Prolactin Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/prolactin-protein-mouse-his.html

Purity

97.00

Smiles

LPICSAGDCQTSLRELFDRVVILSHYIHTLYTDMFIEFDKQYVQDREFMVKVINDCPTSSLATPEDKEQALKVPPEVLLNLILSLVQSSSDPLFQLITGVGGIQEAPEYILSRAKEIEEQNKQLLEGVEKIISQAYPEAKGNGIYFVWSQLPSLQGVDEESKILSLRNTIRCLRRDSHKVDNFLKVLRCQIAHQNNC

Molecular Formula

19109 (Gene_ID) P06879 (L30-C226) (Accession)

Molecular Weight

Approximately 23-24 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD63 Antigen (CD63) Antibody
abx101673-01 100 µL

CD63 Antigen (CD63) Antibody

Sign In for Pricing
View Details
CD63 Antigen (CD63) Antibody
abx101673-02 200 µL

CD63 Antigen (CD63) Antibody

Sign In for Pricing
View Details
CD63 Antigen (CD63) Antibody
abx101673-03 1 mL

CD63 Antigen (CD63) Antibody

Sign In for Pricing
View Details
SDF4 (45kD Calcium-binding Protein, Cab45, Stromal Cell-derived Factor 4, SDF-4, CAB45, PSEC0034) (HRP)
138331-HRP 100 µL

SDF4 (45kD Calcium-binding Protein, Cab45, Stromal Cell-derived Factor 4, SDF-4, CAB45, PSEC0034) (HRP)

Sign In for Pricing
View Details
S-100A15 (m) -PR
sc-45230-PR 10 µM - 20 µL

S-100A15 (m) -PR

Sign In for Pricing
View Details
Presenilin-1 Monoclonal Antibody
E53M01738 100 µL

Presenilin-1 Monoclonal Antibody

Sign In for Pricing
View Details