Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prolactin, Mouse (His)

Prolactin Protein, acting on the mammary gland, plays a pivotal role in promoting lactation through interaction with its receptor, PRLR, facilitating the lactation process.Prolactin Protein, Mouse (His) is the recombinant mouse-derived Prolactin protein, expressed by E.coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Prolactin Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/prolactin-protein-mouse-his.html

Purity

97.00

Smiles

LPICSAGDCQTSLRELFDRVVILSHYIHTLYTDMFIEFDKQYVQDREFMVKVINDCPTSSLATPEDKEQALKVPPEVLLNLILSLVQSSSDPLFQLITGVGGIQEAPEYILSRAKEIEEQNKQLLEGVEKIISQAYPEAKGNGIYFVWSQLPSLQGVDEESKILSLRNTIRCLRRDSHKVDNFLKVLRCQIAHQNNC

Molecular Formula

19109 (Gene_ID) P06879 (L30-C226) (Accession)

Molecular Weight

Approximately 23-24 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Epsin 2 Rabbit Polyclonal Antibody (Cy7)
orb1059108 100 µL

Epsin 2 Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details
ZNF219, CT (Zinc Finger Protein 219) (MaxLight 490)
MBS6506549-01 0.1 mL

ZNF219, CT (Zinc Finger Protein 219) (MaxLight 490)

Sign In for Pricing
View Details
ZNF219, CT (Zinc Finger Protein 219) (MaxLight 490)
MBS6506549-02 5x 0.1 mL

ZNF219, CT (Zinc Finger Protein 219) (MaxLight 490)

Sign In for Pricing
View Details
C1orf113 (SH3D21) Human shRNA Plasmid Kit (Locus ID 79729)
TR306053 1 Kit

C1orf113 (SH3D21) Human shRNA Plasmid Kit (Locus ID 79729)

Sign In for Pricing
View Details
Recombinant Caenorhabditis elegans AT-rich interactive domain-containing protein cfi-1 (cfi-1)
MBS1252191-01 0.02 mg (E-Coli)

Recombinant Caenorhabditis elegans AT-rich interactive domain-containing protein cfi-1 (cfi-1)

Sign In for Pricing
View Details
Recombinant Caenorhabditis elegans AT-rich interactive domain-containing protein cfi-1 (cfi-1)
MBS1252191-02 0.02 mg (Yeast)

Recombinant Caenorhabditis elegans AT-rich interactive domain-containing protein cfi-1 (cfi-1)

Sign In for Pricing
View Details