Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prolactin, Mouse (His)

Prolactin Protein, acting on the mammary gland, plays a pivotal role in promoting lactation through interaction with its receptor, PRLR, facilitating the lactation process.Prolactin Protein, Mouse (His) is the recombinant mouse-derived Prolactin protein, expressed by E.coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Prolactin Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/prolactin-protein-mouse-his.html

Purity

97.00

Smiles

LPICSAGDCQTSLRELFDRVVILSHYIHTLYTDMFIEFDKQYVQDREFMVKVINDCPTSSLATPEDKEQALKVPPEVLLNLILSLVQSSSDPLFQLITGVGGIQEAPEYILSRAKEIEEQNKQLLEGVEKIISQAYPEAKGNGIYFVWSQLPSLQGVDEESKILSLRNTIRCLRRDSHKVDNFLKVLRCQIAHQNNC

Molecular Formula

19109 (Gene_ID) P06879 (L30-C226) (Accession)

Molecular Weight

Approximately 23-24 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Adenosine A2a Receptor (ADORA2a) ELISA Kit
MBS454322-01 48 Tests

Human Adenosine A2a Receptor (ADORA2a) ELISA Kit

Sign In for Pricing
View Details
Human Adenosine A2a Receptor (ADORA2a) ELISA Kit
MBS454322-02 96 Tests

Human Adenosine A2a Receptor (ADORA2a) ELISA Kit

Sign In for Pricing
View Details
Human Adenosine A2a Receptor (ADORA2a) ELISA Kit
MBS454322-03 5x 96 Tests

Human Adenosine A2a Receptor (ADORA2a) ELISA Kit

Sign In for Pricing
View Details
Human Adenosine A2a Receptor (ADORA2a) ELISA Kit
MBS454322-04 10x 96 Tests

Human Adenosine A2a Receptor (ADORA2a) ELISA Kit

Sign In for Pricing
View Details
TRAF3 Antibody
CSB-PA024148GA01HU 100 µL

TRAF3 Antibody

Sign In for Pricing
View Details
EXOSC6, NT (EXOSC6, MTR3, Exosome complex component MTR3, Exosome component 6, mRNA transport regulator 3 homolog, p11) (MaxLight 650) discontinued
035273-ML650 100 µL

EXOSC6, NT (EXOSC6, MTR3, Exosome complex component MTR3, Exosome component 6, mRNA transport regulator 3 homolog, p11) (MaxLight 650) discontinued

Sign In for Pricing
View Details