Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ig Lambda Constant 2, Human (HEK293, His)

The Ig Lambda Constant 2 protein is part of the constant region of the immunoglobulin light chain. It acts as a receptor during the recognition phase of humoral immunity, triggering B lymphocyte expansion and differentiation into plasma cells. Ig Lambda Constant 2 Protein, Human (HEK293, His) is the recombinant human-derived Ig Lambda Constant 2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Ig Lambda Constant 2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ig-lambda-constant-2-protein-human-hek-293-his.html

Purity

95.0

Smiles

GQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS

Molecular Formula

3538 (Gene_ID) P0DOY2 (G1-S106) (Accession)

Molecular Weight

Approximately 16.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

C16orf84 sgRNA CRISPR Lentivector (Human) (Target 3)
K0314004 1.0 µg DNA

C16orf84 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
CKM Type-3 Recombinant Protein
32-2983-50 50 µg

CKM Type-3 Recombinant Protein

Sign In for Pricing
View Details
Mouse Monoclonal EIF4EBP3 Antibody (OTI3B9) [DyLight 350]
NBP2-71383UV 0.1 mL

Mouse Monoclonal EIF4EBP3 Antibody (OTI3B9) [DyLight 350]

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) NAC030 Polyclonal Antibody
MBS7143925 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) NAC030 Polyclonal Antibody

Sign In for Pricing
View Details
Clk4 Rat Pre-designed siRNA Set A
HY-RS23945 1 Set

Clk4 Rat Pre-designed siRNA Set A

Sign In for Pricing
View Details
HYAL3 Protein Vector (Human) (pPB-C-His)
PV020625 500 ng

HYAL3 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details