Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ig Lambda Constant 2, Human (HEK293, His)

The Ig Lambda Constant 2 protein is part of the constant region of the immunoglobulin light chain. It acts as a receptor during the recognition phase of humoral immunity, triggering B lymphocyte expansion and differentiation into plasma cells. Ig Lambda Constant 2 Protein, Human (HEK293, His) is the recombinant human-derived Ig Lambda Constant 2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Ig Lambda Constant 2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ig-lambda-constant-2-protein-human-hek-293-his.html

Purity

95.0

Smiles

GQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS

Molecular Formula

3538 (Gene_ID) P0DOY2 (G1-S106) (Accession)

Molecular Weight

Approximately 16.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IGF2BP1 (NM_001160423) Human Over-expression Lysate
E45H01038-2 20 µg

IGF2BP1 (NM_001160423) Human Over-expression Lysate

Sign In for Pricing
View Details
MURC Antibody
C49331-01 40 µL

MURC Antibody

Sign In for Pricing
View Details
MURC Antibody
C49331-02 100 µL

MURC Antibody

Sign In for Pricing
View Details
MURC Antibody
C49331-03 200 µL

MURC Antibody

Sign In for Pricing
View Details
Insl6 AAV siRNA Pooled Vector
24999164 1.0 µg

Insl6 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
CNGA4 Antibody, Biotin conjugated
CSB-PA808540LD01HU-01 50 µg

CNGA4 Antibody, Biotin conjugated

Sign In for Pricing
View Details