Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ig Lambda Constant 2, Human (HEK293, His)

The Ig Lambda Constant 2 protein is part of the constant region of the immunoglobulin light chain. It acts as a receptor during the recognition phase of humoral immunity, triggering B lymphocyte expansion and differentiation into plasma cells. Ig Lambda Constant 2 Protein, Human (HEK293, His) is the recombinant human-derived Ig Lambda Constant 2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Ig Lambda Constant 2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ig-lambda-constant-2-protein-human-hek-293-his.html

Purity

95.0

Smiles

GQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS

Molecular Formula

3538 (Gene_ID) P0DOY2 (G1-S106) (Accession)

Molecular Weight

Approximately 16.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Cadherin-17 Antibody (CDH17/2618) [FITC]
NBP2-79857F 0.1 mL

Mouse Monoclonal Cadherin-17 Antibody (CDH17/2618) [FITC]

Sign In for Pricing
View Details
beta V TubuLin (TUBB) (NM_178014) Human Tagged ORF Clone Lentiviral Particle
RC203629L2V 200 µL

beta V TubuLin (TUBB) (NM_178014) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
LOC680045 Rat shRNA Plasmid (Locus ID 680045)
TL707888 1 Kit

LOC680045 Rat shRNA Plasmid (Locus ID 680045)

Sign In for Pricing
View Details
Rftn2 siRNA Oligos set (Mouse)
38875174 3x 5 nmol

Rftn2 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
Sodium Acetate Anhydrous 99% Extrapure
02343 05000 5 Kg

Sodium Acetate Anhydrous 99% Extrapure

Sign In for Pricing
View Details
CCT8 antibody
70R-16252 50 ul

CCT8 antibody

Sign In for Pricing
View Details