Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCN2/CTGF, Human (His)

CCN2/CTGF Protein, secreted by vascular endothelial cells, crucially promotes chondrocyte proliferation and differentiation, and mediates heparin- and divalent cation-dependent cell adhesion in diverse cell types. Additionally, it enhances fibroblast growth factor-induced DNA synthesis while existing as a monomer and interacting with TSKU. CCN2/CTGF Protein, Human (His) is the recombinant human-derived CCN2/CTGF protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

CCN2/CTGF Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ccn2-ctgf-protein-human-his.html

Purity

96.00

Smiles

GKKCIRTPKISKPIKFELSGCTSMKTYRAKFCGVCTDGRCCTPHRTTTLPVEFKCPDGEVMKKNMMFIKTCACHYNCPGDNDIFESLYYRKMYGDMA

Molecular Formula

1490 (Gene_ID) P29279 (G253-A349) (Accession)

Molecular Weight

Approximately 12 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSP60 (LK1), CF488A conjugate, 0.1mg/mL
BNC880851-500 1x 500 µL

HSP60 (LK1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD100 (Semaphorin-4D) (A8), CF647 conjugate, 0.1mg/mL
BNC470218-100 1x 100 µL

CD100 (Semaphorin-4D) (A8), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF488A conjugate, 0.1mg/mL
BNC880806-500 1x 500 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF568 conjugate, 0.1mg/mL
BNC680270-500 1x 500 µL

Fibronectin (HFN7.1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C-Myc Oncoprotein (MYC2895R), CF640R conjugate, 0.1mg/mL
BNC402895-500 1x 500 µL

C-Myc Oncoprotein (MYC2895R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PLAP (Placental Alkaline Phosphatase) (GM022), CF660R conjugate, 0.1mg/mL
BNC610874-100 1x 100 µL

PLAP (Placental Alkaline Phosphatase) (GM022), CF660R conjugate, 0.1mg/mL

Sign In for Pricing
View Details