Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSCA, Mouse (P.pastoris, His)

PSCA protein is a multifunctional regulator that may modulate cell proliferation and act as a modulator of nicotinic acetylcholine receptor (nAChR) activity. In vitro experiments showed that it can inhibit nicotine-induced signaling, suggesting interaction with nAChR containing α-3:β-2 or α-7. PSCA Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived PSCA protein, expressed by P. pastoris , with N-His labeled tag.

Product Specifications

Product Name Alternative

PSCA Protein, Mouse (P.pastoris, His), Mouse, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/psca-protein-mouse-p-pastoris-his.html

Smiles

LQCYSCTAQMNNRDCLNVQNCSLDQHSCFTSRIRAIGLVTVISKGCSSQCEDDSENYYLGKKNITCCYSDLCNVN

Molecular Formula

72373 (Gene_ID) P57096 (L21-N95) (Accession)

Molecular Weight

Approximately 10.4 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF33B Human Gene Knockout Kit (CRISPR)
KN423391 1 Kit

ZNF33B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mucin 3 (MUC3/1154), CF594 conjugate, 0.1mg/mL
BNC941154-100 1x 100 µL

Mucin 3 (MUC3/1154), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
2-Vinylthiophene (Stabilized with BHT)
TRC-V756998-50MG 50 mg

2-Vinylthiophene (Stabilized with BHT)

Sign In for Pricing
View Details
Recombinant Human BUP1 Protein (His Tag)
PKSH033271-01 10 µg

Recombinant Human BUP1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human BUP1 Protein (His Tag)
PKSH033271-02 50 µg

Recombinant Human BUP1 Protein (His Tag)

Sign In for Pricing
View Details
ZNF69 Mouse Monoclonal Antibody [Clone ID: OTI2B6]
CF808644 100 µg

ZNF69 Mouse Monoclonal Antibody [Clone ID: OTI2B6]

Sign In for Pricing
View Details