Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD38, Cynomolgus (HEK293, His)

The CD38 protein plays multifaceted roles in cell signaling and is critical for the synthesis of cyclic ADP-ribose (cADPR) as a possible second messenger in glucose-induced insulin secretion. CD38 also promotes calcium mobilization through the synthesis of niacin adenine dinucleotide phosphate (NAADP+) and exhibits cADPR hydrolase activity. CD38 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD38 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD38 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd38-protein-cynomolgus-hek-293-his.html

Purity

95.0

Smiles

LPRWRQQWSGSGTTSRFPETVLARCVKYTEVHPEMRHVDCQSVWDAFKGAFISKYPCNITEEDYQPLVKLGTQTVPCNKTLLWSRIKDLAHQFTQVQRDMFTLEDMLLGYLADDLTWCGEFNTFEINYQSCPDWRKDCSNNPVSVFWKTVSRRFAETACGVVHVMLNGSRSKIFDKNSTFGSVEVHNLQPEKVQALEAWVIHGGREDSRDLCQDPTIKELESIISKRNIRFFCKNIYRPDKFLQCVKNPEDSSCLSGI

Molecular Formula

102126394 (Gene_ID) Q5VAN0 (L44-I301) (Accession)

Molecular Weight

38-50 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tlr8 sgRNA CRISPR Lentivector (Rat) (Target 2)
K6725803 1.0 µg DNA

Tlr8 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
RPL10AP5 sgRNA CRISPR Lentivector (Human) (Target 1)
K1899002 1.0 µg DNA

RPL10AP5 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
ADORA3 (MaxLight 650) discontinued
302251-ML650 100 µL

ADORA3 (MaxLight 650) discontinued

Sign In for Pricing
View Details
Par-6 Partitioning Defective 6 Homolog beta Protein
abx263325-01 2 µg

Par-6 Partitioning Defective 6 Homolog beta Protein

Sign In for Pricing
View Details
Par-6 Partitioning Defective 6 Homolog beta Protein
abx263325-02 10 µg

Par-6 Partitioning Defective 6 Homolog beta Protein

Sign In for Pricing
View Details
Par-6 Partitioning Defective 6 Homolog beta Protein
abx263325-03 100 µg

Par-6 Partitioning Defective 6 Homolog beta Protein

Sign In for Pricing
View Details