Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD38, Cynomolgus (HEK293, His)

The CD38 protein plays multifaceted roles in cell signaling and is critical for the synthesis of cyclic ADP-ribose (cADPR) as a possible second messenger in glucose-induced insulin secretion. CD38 also promotes calcium mobilization through the synthesis of niacin adenine dinucleotide phosphate (NAADP+) and exhibits cADPR hydrolase activity. CD38 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD38 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD38 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd38-protein-cynomolgus-hek-293-his.html

Purity

95.0

Smiles

LPRWRQQWSGSGTTSRFPETVLARCVKYTEVHPEMRHVDCQSVWDAFKGAFISKYPCNITEEDYQPLVKLGTQTVPCNKTLLWSRIKDLAHQFTQVQRDMFTLEDMLLGYLADDLTWCGEFNTFEINYQSCPDWRKDCSNNPVSVFWKTVSRRFAETACGVVHVMLNGSRSKIFDKNSTFGSVEVHNLQPEKVQALEAWVIHGGREDSRDLCQDPTIKELESIISKRNIRFFCKNIYRPDKFLQCVKNPEDSSCLSGI

Molecular Formula

102126394 (Gene_ID) Q5VAN0 (L44-I301) (Accession)

Molecular Weight

38-50 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

INTS1, NT (INTS1, KIAA1440, Integrator complex subunit 1) (MaxLight 750)
MBS6310672-01 0.1 mL

INTS1, NT (INTS1, KIAA1440, Integrator complex subunit 1) (MaxLight 750)

Sign In for Pricing
View Details
INTS1, NT (INTS1, KIAA1440, Integrator complex subunit 1) (MaxLight 750)
MBS6310672-02 5x 0.1 mL

INTS1, NT (INTS1, KIAA1440, Integrator complex subunit 1) (MaxLight 750)

Sign In for Pricing
View Details
Lentiviral human PSTPIP1 shRNA (UAS) - Lentiviral human PSTPIP1 shRNA (UAS, RFP) (25)
GTR15084923 1 Vial

Lentiviral human PSTPIP1 shRNA (UAS) - Lentiviral human PSTPIP1 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Genorise® Equine cTnC polyclonal antibody
GR105275 100 µg

Genorise® Equine cTnC polyclonal antibody

Sign In for Pricing
View Details
NBR1 (NM_001291572) Human Tagged ORF Clone
RC239654 10 µg

NBR1 (NM_001291572) Human Tagged ORF Clone

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli (strain K12) DPS Polyclonal Antibody
MBS7165773 Inquire

Rabbit anti-Escherichia coli (strain K12) DPS Polyclonal Antibody

Sign In for Pricing
View Details