Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD38, Cynomolgus (HEK293, His)

The CD38 protein plays multifaceted roles in cell signaling and is critical for the synthesis of cyclic ADP-ribose (cADPR) as a possible second messenger in glucose-induced insulin secretion. CD38 also promotes calcium mobilization through the synthesis of niacin adenine dinucleotide phosphate (NAADP+) and exhibits cADPR hydrolase activity. CD38 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD38 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD38 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd38-protein-cynomolgus-hek-293-his.html

Purity

95.0

Smiles

LPRWRQQWSGSGTTSRFPETVLARCVKYTEVHPEMRHVDCQSVWDAFKGAFISKYPCNITEEDYQPLVKLGTQTVPCNKTLLWSRIKDLAHQFTQVQRDMFTLEDMLLGYLADDLTWCGEFNTFEINYQSCPDWRKDCSNNPVSVFWKTVSRRFAETACGVVHVMLNGSRSKIFDKNSTFGSVEVHNLQPEKVQALEAWVIHGGREDSRDLCQDPTIKELESIISKRNIRFFCKNIYRPDKFLQCVKNPEDSSCLSGI

Molecular Formula

102126394 (Gene_ID) Q5VAN0 (L44-I301) (Accession)

Molecular Weight

38-50 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TrkC (NTRK3) (NM_001007156) Human Recombinant Protein
TP303781L 1 mg

TrkC (NTRK3) (NM_001007156) Human Recombinant Protein

Sign In for Pricing
View Details
Simian PAI1 ELISA Kit
E109185 1 Each

Simian PAI1 ELISA Kit

Sign In for Pricing
View Details
Rabbit Anti-SAA1 Polyclonal Antibody
PAV3565 100 μL

Rabbit Anti-SAA1 Polyclonal Antibody

Sign In for Pricing
View Details
Printer paper (W:57mm L:24m)
207947 1 Each

Printer paper (W:57mm L:24m)

Sign In for Pricing
View Details
Density Std 0.9777g/mL at 50C - 100ML
DEN50140 100 mL

Density Std 0.9777g/mL at 50C - 100ML

Sign In for Pricing
View Details
RPS29P9 sgRNA CRISPR Lentivector (Human) (Target 3)
K2060904 1.0 µg DNA

RPS29P9 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details