Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD38, Cynomolgus (HEK293, His)

The CD38 protein plays multifaceted roles in cell signaling and is critical for the synthesis of cyclic ADP-ribose (cADPR) as a possible second messenger in glucose-induced insulin secretion. CD38 also promotes calcium mobilization through the synthesis of niacin adenine dinucleotide phosphate (NAADP+) and exhibits cADPR hydrolase activity. CD38 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD38 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD38 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd38-protein-cynomolgus-hek-293-his.html

Purity

95.0

Smiles

LPRWRQQWSGSGTTSRFPETVLARCVKYTEVHPEMRHVDCQSVWDAFKGAFISKYPCNITEEDYQPLVKLGTQTVPCNKTLLWSRIKDLAHQFTQVQRDMFTLEDMLLGYLADDLTWCGEFNTFEINYQSCPDWRKDCSNNPVSVFWKTVSRRFAETACGVVHVMLNGSRSKIFDKNSTFGSVEVHNLQPEKVQALEAWVIHGGREDSRDLCQDPTIKELESIISKRNIRFFCKNIYRPDKFLQCVKNPEDSSCLSGI

Molecular Formula

102126394 (Gene_ID) Q5VAN0 (L44-I301) (Accession)

Molecular Weight

38-50 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Magic™ Membrane Protein Human GJB1 (Gap junction protein beta 1) Expressed in vitro E.coli expression system, Full Length
MPX2381K Each

Magic™ Membrane Protein Human GJB1 (Gap junction protein beta 1) Expressed in vitro E.coli expression system, Full Length

Sign In for Pricing
View Details
MAST205 CRISPR/Cas9 KO Plasmid (h)
sc-409835 20 µg

MAST205 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
NUDCD1 polyclonal antibody
BS76543-01 50 µL

NUDCD1 polyclonal antibody

Sign In for Pricing
View Details
NUDCD1 polyclonal antibody
BS76543-02 100 µL

NUDCD1 polyclonal antibody

Sign In for Pricing
View Details
Rabbit Polyclonal to Human ERBB4 / HER4
MBS240068-01 0.05 mg

Rabbit Polyclonal to Human ERBB4 / HER4

Sign In for Pricing
View Details
Rabbit Polyclonal to Human ERBB4 / HER4
MBS240068-02 5x 0.05 mg

Rabbit Polyclonal to Human ERBB4 / HER4

Sign In for Pricing
View Details