Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD38, Cynomolgus (HEK293, His)

The CD38 protein plays multifaceted roles in cell signaling and is critical for the synthesis of cyclic ADP-ribose (cADPR) as a possible second messenger in glucose-induced insulin secretion. CD38 also promotes calcium mobilization through the synthesis of niacin adenine dinucleotide phosphate (NAADP+) and exhibits cADPR hydrolase activity. CD38 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD38 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD38 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd38-protein-cynomolgus-hek-293-his.html

Purity

95.0

Smiles

LPRWRQQWSGSGTTSRFPETVLARCVKYTEVHPEMRHVDCQSVWDAFKGAFISKYPCNITEEDYQPLVKLGTQTVPCNKTLLWSRIKDLAHQFTQVQRDMFTLEDMLLGYLADDLTWCGEFNTFEINYQSCPDWRKDCSNNPVSVFWKTVSRRFAETACGVVHVMLNGSRSKIFDKNSTFGSVEVHNLQPEKVQALEAWVIHGGREDSRDLCQDPTIKELESIISKRNIRFFCKNIYRPDKFLQCVKNPEDSSCLSGI

Molecular Formula

102126394 (Gene_ID) Q5VAN0 (L44-I301) (Accession)

Molecular Weight

38-50 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Slc47a1 (NM_026183) Mouse Tagged ORF Clone
MR224005 10 µg

Slc47a1 (NM_026183) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS503497 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
Rabbit Polyclonal ZSCAN4 Antibody [DyLight 594]
NBP1-77120DL594 0.1 mL

Rabbit Polyclonal ZSCAN4 Antibody [DyLight 594]

Sign In for Pricing
View Details
Mouse Monoclonal Fibronectin Antibody (960632) [DyLight 488]
MAB8258G 100 µL

Mouse Monoclonal Fibronectin Antibody (960632) [DyLight 488]

Sign In for Pricing
View Details
GDF5 BioAssayTM ELISA Kit (Porcine)
396673 96 Tests

GDF5 BioAssayTM ELISA Kit (Porcine)

Sign In for Pricing
View Details
PCDHA9 Protein Vector (Human) (pPB-C-His)
PV109918 500 ng

PCDHA9 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details