Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD38, Cynomolgus (HEK293, His)

The CD38 protein plays multifaceted roles in cell signaling and is critical for the synthesis of cyclic ADP-ribose (cADPR) as a possible second messenger in glucose-induced insulin secretion. CD38 also promotes calcium mobilization through the synthesis of niacin adenine dinucleotide phosphate (NAADP+) and exhibits cADPR hydrolase activity. CD38 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD38 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD38 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd38-protein-cynomolgus-hek-293-his.html

Purity

95.0

Smiles

LPRWRQQWSGSGTTSRFPETVLARCVKYTEVHPEMRHVDCQSVWDAFKGAFISKYPCNITEEDYQPLVKLGTQTVPCNKTLLWSRIKDLAHQFTQVQRDMFTLEDMLLGYLADDLTWCGEFNTFEINYQSCPDWRKDCSNNPVSVFWKTVSRRFAETACGVVHVMLNGSRSKIFDKNSTFGSVEVHNLQPEKVQALEAWVIHGGREDSRDLCQDPTIKELESIISKRNIRFFCKNIYRPDKFLQCVKNPEDSSCLSGI

Molecular Formula

102126394 (Gene_ID) Q5VAN0 (L44-I301) (Accession)

Molecular Weight

38-50 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

QRICH1 (NM_198880) Human Tagged ORF Clone Lentiviral Particle
RC211088L4V 200 µL

QRICH1 (NM_198880) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
CAY10575
B2912-1 1 mg

CAY10575

Sign In for Pricing
View Details
Rabbit anti-Caenorhabditis elegans gly-8 Polyclonal Antibody
MBS7181651 Inquire

Rabbit anti-Caenorhabditis elegans gly-8 Polyclonal Antibody

Sign In for Pricing
View Details
EIF3K Antibody
A13421-100UG 100 µg

EIF3K Antibody

Sign In for Pricing
View Details
VIPR2 (VIPR2, C16DUPq36.3, 6.3, PACAP-R-3, Pvr3, Vip Type-2 Receptor, Vip-r2, Vip2 Receptor, PACAP Type III Receptor, Pacap Type-3, PACAP-R3, PACAPR-3, VIP and PACAP Receptor 2, VIP-R-2, VIP2R, VPAC2, VPCAP2R, PACAP3, Vip2, VPAC2R)
171402 50 µg

VIPR2 (VIPR2, C16DUPq36.3, 6.3, PACAP-R-3, Pvr3, Vip Type-2 Receptor, Vip-r2, Vip2 Receptor, PACAP Type III Receptor, Pacap Type-3, PACAP-R3, PACAPR-3, VIP and PACAP Receptor 2, VIP-R-2, VIP2R, VPAC2, VPCAP2R, PACAP3, Vip2, VPAC2R)

Sign In for Pricing
View Details
Nup43 Mouse Gene Knockout Kit (CRISPR)
KN511355 1 Kit

Nup43 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details