Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD38, Cynomolgus (HEK293, His)

The CD38 protein plays multifaceted roles in cell signaling and is critical for the synthesis of cyclic ADP-ribose (cADPR) as a possible second messenger in glucose-induced insulin secretion. CD38 also promotes calcium mobilization through the synthesis of niacin adenine dinucleotide phosphate (NAADP+) and exhibits cADPR hydrolase activity. CD38 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD38 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD38 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd38-protein-cynomolgus-hek-293-his.html

Purity

95.0

Smiles

LPRWRQQWSGSGTTSRFPETVLARCVKYTEVHPEMRHVDCQSVWDAFKGAFISKYPCNITEEDYQPLVKLGTQTVPCNKTLLWSRIKDLAHQFTQVQRDMFTLEDMLLGYLADDLTWCGEFNTFEINYQSCPDWRKDCSNNPVSVFWKTVSRRFAETACGVVHVMLNGSRSKIFDKNSTFGSVEVHNLQPEKVQALEAWVIHGGREDSRDLCQDPTIKELESIISKRNIRFFCKNIYRPDKFLQCVKNPEDSSCLSGI

Molecular Formula

102126394 (Gene_ID) Q5VAN0 (L44-I301) (Accession)

Molecular Weight

38-50 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPS7 Polyclonal Antibody
RD84040A-01 60 μL

RPS7 Polyclonal Antibody

Sign In for Pricing
View Details
RPS7 Polyclonal Antibody
RD84040A-02 120 μL

RPS7 Polyclonal Antibody

Sign In for Pricing
View Details
RPS7 Polyclonal Antibody
RD84040A-03 200 µL

RPS7 Polyclonal Antibody

Sign In for Pricing
View Details
BSDC1 (NM_001143889) Human Tagged ORF Clone Lentiviral Particle
RC227662L3V 200 µL

BSDC1 (NM_001143889) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Glt6d1 (NM_001039095) Mouse Tagged ORF Clone
MR220773 10 µg

Glt6d1 (NM_001039095) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Anti-CHRNA10 Antibody
MBS820586-01 0.03 mL

Anti-CHRNA10 Antibody

Sign In for Pricing
View Details