Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD38, Cynomolgus (HEK293, His)

The CD38 protein plays multifaceted roles in cell signaling and is critical for the synthesis of cyclic ADP-ribose (cADPR) as a possible second messenger in glucose-induced insulin secretion. CD38 also promotes calcium mobilization through the synthesis of niacin adenine dinucleotide phosphate (NAADP+) and exhibits cADPR hydrolase activity. CD38 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD38 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD38 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd38-protein-cynomolgus-hek-293-his.html

Purity

95.0

Smiles

LPRWRQQWSGSGTTSRFPETVLARCVKYTEVHPEMRHVDCQSVWDAFKGAFISKYPCNITEEDYQPLVKLGTQTVPCNKTLLWSRIKDLAHQFTQVQRDMFTLEDMLLGYLADDLTWCGEFNTFEINYQSCPDWRKDCSNNPVSVFWKTVSRRFAETACGVVHVMLNGSRSKIFDKNSTFGSVEVHNLQPEKVQALEAWVIHGGREDSRDLCQDPTIKELESIISKRNIRFFCKNIYRPDKFLQCVKNPEDSSCLSGI

Molecular Formula

102126394 (Gene_ID) Q5VAN0 (L44-I301) (Accession)

Molecular Weight

38-50 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Amyloid β43 Rabbit Polyclonal Antibody
E53P01045 100 µL

Amyloid β43 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Nrsn1 sgRNA CRISPR Lentivector set (Mouse)
K3363201 3x 1.0 µg

Nrsn1 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
PRRX1 Over-expression Lysate Product
GWB-B97734 0.1 mg

PRRX1 Over-expression Lysate Product

Sign In for Pricing
View Details
Olfr1164 Mouse shRNA Plasmid (Locus ID 258634)
TR507820 1 Kit

Olfr1164 Mouse shRNA Plasmid (Locus ID 258634)

Sign In for Pricing
View Details
Loxiglumide (CR1505) 25mg
A11769-25 25 mg

Loxiglumide (CR1505) 25mg

Sign In for Pricing
View Details
Goose Voltage-Gated Potassium Channel Subunit Beta-1 (KCNAB1) ELISA Kit
MBS9936979 Inquire

Goose Voltage-Gated Potassium Channel Subunit Beta-1 (KCNAB1) ELISA Kit

Sign In for Pricing
View Details