Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD38, Cynomolgus (HEK293, His)

The CD38 protein plays multifaceted roles in cell signaling and is critical for the synthesis of cyclic ADP-ribose (cADPR) as a possible second messenger in glucose-induced insulin secretion. CD38 also promotes calcium mobilization through the synthesis of niacin adenine dinucleotide phosphate (NAADP+) and exhibits cADPR hydrolase activity. CD38 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD38 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD38 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd38-protein-cynomolgus-hek-293-his.html

Purity

95.0

Smiles

LPRWRQQWSGSGTTSRFPETVLARCVKYTEVHPEMRHVDCQSVWDAFKGAFISKYPCNITEEDYQPLVKLGTQTVPCNKTLLWSRIKDLAHQFTQVQRDMFTLEDMLLGYLADDLTWCGEFNTFEINYQSCPDWRKDCSNNPVSVFWKTVSRRFAETACGVVHVMLNGSRSKIFDKNSTFGSVEVHNLQPEKVQALEAWVIHGGREDSRDLCQDPTIKELESIISKRNIRFFCKNIYRPDKFLQCVKNPEDSSCLSGI

Molecular Formula

102126394 (Gene_ID) Q5VAN0 (L44-I301) (Accession)

Molecular Weight

38-50 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAGE (Receptor for Advanced Glycosylation End Products, Advanced Glycosylation End Product-specific Receptor, AGER) (MaxLight 550)
MBS6246171-01 0.1 mL

RAGE (Receptor for Advanced Glycosylation End Products, Advanced Glycosylation End Product-specific Receptor, AGER) (MaxLight 550)

Sign In for Pricing
View Details
RAGE (Receptor for Advanced Glycosylation End Products, Advanced Glycosylation End Product-specific Receptor, AGER) (MaxLight 550)
MBS6246171-02 5x 0.1 mL

RAGE (Receptor for Advanced Glycosylation End Products, Advanced Glycosylation End Product-specific Receptor, AGER) (MaxLight 550)

Sign In for Pricing
View Details
PLV3-U6-ATG5-sgRNA2-Cas9-Puro Plasmid
PVT64054 2 µg

PLV3-U6-ATG5-sgRNA2-Cas9-Puro Plasmid

Sign In for Pricing
View Details
Trichophyton tonsurans RT PCR kit
RTq-H693-150D 150T

Trichophyton tonsurans RT PCR kit

Sign In for Pricing
View Details
MGAT3 (mannosyl (beta-1,4-)-Glycoprotein beta-1,4-N-acetylglucosaminyltransferase, FLJ43371, GNT-III, GNT3, MGC141943, MGC142278) (HRP)
MBS6182160-01 0.1 mL

MGAT3 (mannosyl (beta-1,4-)-Glycoprotein beta-1,4-N-acetylglucosaminyltransferase, FLJ43371, GNT-III, GNT3, MGC141943, MGC142278) (HRP)

Sign In for Pricing
View Details
MGAT3 (mannosyl (beta-1,4-)-Glycoprotein beta-1,4-N-acetylglucosaminyltransferase, FLJ43371, GNT-III, GNT3, MGC141943, MGC142278) (HRP)
MBS6182160-02 5x 0.1 mL

MGAT3 (mannosyl (beta-1,4-)-Glycoprotein beta-1,4-N-acetylglucosaminyltransferase, FLJ43371, GNT-III, GNT3, MGC141943, MGC142278) (HRP)

Sign In for Pricing
View Details