Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Alpha-synuclein (SNCA), partial

Product Specifications

Product Name Alternative

Non-A beta component of AD amyloid; Non-A4 component of amyloid precursor; NACP

Abbreviation

Recombinant Human SNCA protein, partial

Gene Name

SNCA

UniProt

P37840

Expression Region

1-139aa

Organism

Homo sapiens (Human)

Target Sequence

MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPE

Tag

Tag-Free

Type

Developed Protein

Source

E.coli

Field of Research

Neuroscience

Relevance

Neuronal protein that plays several roles in synaptic activity such as regulation of synaptic vesicle trafficking and subsequent neurotransmitter release. Participates as a monomer in synaptic vesicle exocytosis by enhancing vesicle priming, fusion and dilation of exocytotic fusion pores. Mechanistically, acts by increasing local Ca (2+) release from microdomains which is essential for the enhancement of ATP-induced exocytosis. Acts also as a molecular chaperone in its multimeric membrane-bound state, assisting in the folding of synaptic fusion components called SNAREs (Soluble NSF Attachment Protein REceptors) at presynaptic plasma membrane in conjunction with cysteine string protein-alpha/DNAJC5. This chaperone activity is important to sustain normal SNARE-complex assembly during aging. Also plays a role in the regulation of the dopamine neurotransmission by associating with the dopamine transporter (DAT1) and thereby modulating its activity.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

41.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-PHF17 Rabbit pAb
GB113943-50 50 μL

Anti-PHF17 Rabbit pAb

Sign In for Pricing
View Details
Meltblown Cartridge, Polypro,1μm, Gen Purpose,40",28/63mm,226/Flat, Polypro, EPDM, Standard, Smooth Gr.D, Bag-Label
CFMPP0100G40ZBG2PESS 1 Piece/Case:1 Piece/ PACKS:1 PACKS/CASE

Meltblown Cartridge, Polypro,1μm, Gen Purpose,40",28/63mm,226/Flat, Polypro, EPDM, Standard, Smooth Gr.D, Bag-Label

Sign In for Pricing
View Details
HIGD2B Rabbit Polyclonal Antibody (PerCP)
orb2499219 100 µL

HIGD2B Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
PROTAC MPS1 degrader 1
orb2695471-01 10 mg

PROTAC MPS1 degrader 1

Sign In for Pricing
View Details
PROTAC MPS1 degrader 1
orb2695471-02 50 mg

PROTAC MPS1 degrader 1

Sign In for Pricing
View Details
Human Olfactory receptor 1F1 (OR1F1) ELISA Kit
MBS7208582-01 48 Well

Human Olfactory receptor 1F1 (OR1F1) ELISA Kit

Sign In for Pricing
View Details