Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AITRL/TNFSF18 Trimer, Human (Biotinylated, HEK293, His-Flag)

Selected Variant

HY-P78133-01

Size: 20 µg

AITRL, a type II transmembrane protein, is a ligand for glucocorticoid-induced TNFR-related protein (GITR) . When AITRL binds to GITR, GITR can produce costimulatory signals that regulate T-cell proliferation and effector functions. GITR/AITRL interaction plays a role in the pathogenesis of tumor, inflammation, as well as autoimmune diseases[1]. Besides, AITRL plays a role in endothelial cells (EC) -activation and increases STAT-1 phosphorylation and the expression of adhesion molecules (VCAM-1, ICAM-1) [2]. AITRL/TNFSF18 Protein, Human (Biotinylated, HEK293, His-Flag) is a recombinant biotinylated human AITRL (Q72-S199) with N-terminal His and Flag tag, which is expressed in HEK293.

Product Specifications

Product Name Alternative

AITRL/TNFSF18 Trimer Protein, Human (Biotinylated, HEK293, His-Flag), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/aitrl-tnfsf18-protein-human-biotinylated-hek293-his-flag.html

Purity

95.0

Smiles

QLETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFIS

Molecular Formula

8995 (Gene_ID) Q9UNG2 (Q50-S177) (Accession)

Molecular Weight

Approximately 50-70 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Tian J, et al. The Role of GITR/GITRL Interaction in Autoimmune Diseases. Front Immunol. 2020 Oct 9;11:588682.|[2]Lacal PM, et al. Glucocorticoid-induced tumor necrosis factor receptor family-related ligand triggering upregulates vascular cell adhesion molecule-1 and intercellular adhesion molecule-1 and promotes leukocyte adhesion. J Pharmacol Exp Ther. 2013 Oct;347 (1) :164-72.|[3]Wang F, et al. Structures of mouse and human GITR-GITRL complexes reveal unique TNF superfamily interactions. Nat Commun. 2021 Mar 2;12 (1) :1378.|[4]Placke T, et al. Glucocorticoid-induced TNFR-related (GITR) protein and its ligand in antitumor immunity: functional role and therapeutic modulation. Clin Dev Immunol. 2010;2010:239083.|[5]Tian J, et al. Increased GITRL Impairs the Function of Myeloid-Derived Suppressor Cells and Exacerbates Primary Sjögren Syndrome. J Immunol. 2019 Mar 15;202 (6) :1693-1703.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Price

Sign In for Pricing

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44v9 (Marker of Tumor Metastasis) (CD44v9/2344R), CF568 conjugate, 0.1mg/mL
BNC682344-500 1x 500 µL

CD44v9 (Marker of Tumor Metastasis) (CD44v9/2344R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cyclin B1 (CCNB1/1098), Biotin conjugate, 0.1mg/mL
BNCB1098-500 1x 500 µL

Cyclin B1 (CCNB1/1098), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Involucrin (SY5), 1mg/mL
BNUM0678-50 1x 50 µL

Involucrin (SY5), 1mg/mL

Sign In for Pricing
View Details
Glypican-3 (GPC3) (Hepatocellular Carcinoma Marker) (rGPC3/863), CF488A conjugate, 0.1mg/mL
BNC881846-100 1x 100 µL

Glypican-3 (GPC3) (Hepatocellular Carcinoma Marker) (rGPC3/863), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GAD1 / GAD67 (GABAergic Neuronal Marker) (GAD1/2391), Biotin conjugate, 0.1mg/mL
BNCB2391-500 1x 500 µL

GAD1 / GAD67 (GABAergic Neuronal Marker) (GAD1/2391), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Catenin, beta (CTNNB1) (CTNNB1/2030R), 0.2mg/mL
BNUB2030-100 1x 100 µL

Catenin, beta (CTNNB1) (CTNNB1/2030R), 0.2mg/mL

Sign In for Pricing
View Details