Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CREB-binding protein (CREBBP), partial

Product Specifications

Product Name Alternative

Histone lysine acetyltransferase CREBBP; Protein-lysine acetyltransferase CREBBP

Abbreviation

Recombinant Human CREBBP protein, partial

Gene Name

CREBBP

UniProt

Q92793

Expression Region

1081-1197aa

Organism

Homo sapiens (Human)

Target Sequence

RKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLG

Tag

N-terminal GST-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cancer

Relevance

Acetylates histones, giving a specific tag for transcriptional activation (PubMed:24616510) . Also acetylates non-histone proteins, like DDX21, FBL, IRF2, MAFG, NCOA3, POLR1E/PAF53 and FOXO1 (PubMed:10490106, PubMed:11154691, PubMed:12738767, PubMed:12929931, PubMed:9707565, PubMed:24207024, PubMed:28790157, PubMed:30540930) . Binds specifically to phosphorylated CREB and enhances its transcriptional activity toward cAMP-responsive genes. Acts as a coactivator of ALX1. Acts as a circadian transcriptional coactivator which enhances the activity of the circadian transcriptional activators: NPAS2-ARNTL/BMAL1 and CLOCK-ARNTL/BMAL1 heterodimers (PubMed:14645221) . Acetylates PCNA; acetylation promotes removal of chromatin-bound PCNA and its degradation during nucleotide excision repair (NER) (PubMed:24939902) . Acetylates POLR1E/PAF53, leading to decreased association of RNA polymerase I with the rDNA promoter region and coding region (PubMed:24207024) . Acetylates DDX21, thereby inhibiting DDX21 helicase activity (PubMed:28790157) . Acetylates FBL, preventing methylation of 'Gln-105' of histone H2A (H2AQ104me) (PubMed:30540930) . Functions as a transcriptional coactivator for SMAD4 in the TGF-beta signaling pathway (PubMed:25514493) .

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

40.7 kDa

References & Citations

"SIRT7 and the DEAD-box helicase DDX21 cooperate to resolve genomic R loops and safeguard genome stability." Song C., Hotz-Wagenblatt A., Voit R., Grummt I. Genes Dev. 31:1370-1381 (2017)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant ELP4 Antibody
RC-16512-01 50 μL

Recombinant ELP4 Antibody

Sign In for Pricing
View Details
Recombinant ELP4 Antibody
RC-16512-02 100 µL

Recombinant ELP4 Antibody

Sign In for Pricing
View Details
Recombinant ELP4 Antibody
RC-16512-03 1 mL

Recombinant ELP4 Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Bone: femur, head
CS706974 5x 5 µm

Tissue FFPE Sections, Bone: femur, head

Sign In for Pricing
View Details
4-Chloro-2-butanone
TRC-C292860-5G 5 g

4-Chloro-2-butanone

Sign In for Pricing
View Details
n-Undecane-d24
TRC-N211126-5MG 5 mg

n-Undecane-d24

Sign In for Pricing
View Details