Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARL2BP, Human (His)

The ARL2BP protein cooperates with ARL2 to play a crucial role in the nuclear translocation, retention, and transcriptional activity of STAT3, highlighting its cellular involvement. As a potential effector of ARL2, ARL2BP forms a complex with ARL2, SLC25A6, and ARL3. ARL2BP Protein, Human (His) is the recombinant human-derived ARL2BP protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

ARL2BP Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/arl2bp-protein-human-his.html

Purity

95.0

Smiles

MDALEGESFALSFSSASDAEFDAVVGYLEDIIMDDEFQLLQRNFMDKYYLEFEDTEENKLIYTPIFNEYISLVEKYIEEQLLQRIPEFNMAAFTTTLQHHKDEVAGDIFDMLLTFTDFLAFKEMFLDYRAEKEGRGLDLSSGLVVTSLCKSSSLPASQNNLRH

Molecular Formula

23568 (Gene_ID) Q9Y2Y0-1 (M1-H163) (Accession)

Molecular Weight

Approximately 21 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phalloidin-AMCA Conjugate
23100-AAT 300 Tests

Phalloidin-AMCA Conjugate

Sign In for Pricing
View Details
Parathyroid hormone related protein (PTHLH) (107-111) Rabbit Polyclonal Antibody
AP02157SU-S 20 µL

Parathyroid hormone related protein (PTHLH) (107-111) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Gstm5 Rabbit Polyclonal Antibody
TA363219 100 µL

Gstm5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Meniscus
CS708824 5x 5 µm

Tissue FFPE Sections, Meniscus

Sign In for Pricing
View Details
TMEM17 (NM_198276) Human Recombinant Protein
TP308232L 1 mg

TMEM17 (NM_198276) Human Recombinant Protein

Sign In for Pricing
View Details
IDH2 (NM_002168) Human Recombinant Protein
TP710214 20 µg

IDH2 (NM_002168) Human Recombinant Protein

Sign In for Pricing
View Details