ARL2BP, Human (His)
The ARL2BP protein cooperates with ARL2 to play a crucial role in the nuclear translocation, retention, and transcriptional activity of STAT3, highlighting its cellular involvement. As a potential effector of ARL2, ARL2BP forms a complex with ARL2, SLC25A6, and ARL3. ARL2BP Protein, Human (His) is the recombinant human-derived ARL2BP protein, expressed by E. coli , with N-6*His labeled tag.
Product Specifications
Product Name Alternative
ARL2BP Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/arl2bp-protein-human-his.html
Purity
95.0
Smiles
MDALEGESFALSFSSASDAEFDAVVGYLEDIIMDDEFQLLQRNFMDKYYLEFEDTEENKLIYTPIFNEYISLVEKYIEEQLLQRIPEFNMAAFTTTLQHHKDEVAGDIFDMLLTFTDFLAFKEMFLDYRAEKEGRGLDLSSGLVVTSLCKSSSLPASQNNLRH
Molecular Formula
23568 (Gene_ID) Q9Y2Y0-1 (M1-H163) (Accession)
Molecular Weight
Approximately 21 kDa.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC473350-500 1x 500 µL
NKX3.1 (Metastatic Prostate Adenocarcinoma Marker) (NKX3.1/3350), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680245-100 1x 100 µL
SHBG (Sex Hormone Binding Globulin) (SHBG/245), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC682775-500 1x 500 µL
Vimentin (Mesenchymal Cell Marker) (V9), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
HA751612 100 µL
Glutathione Peroxidase 3 / GPx-3 Recombinant Rabbit monoclonal Antibody
Sign In for Pricing
View Details 