Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARL2BP, Human (His)

The ARL2BP protein cooperates with ARL2 to play a crucial role in the nuclear translocation, retention, and transcriptional activity of STAT3, highlighting its cellular involvement. As a potential effector of ARL2, ARL2BP forms a complex with ARL2, SLC25A6, and ARL3. ARL2BP Protein, Human (His) is the recombinant human-derived ARL2BP protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

ARL2BP Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/arl2bp-protein-human-his.html

Purity

95.0

Smiles

MDALEGESFALSFSSASDAEFDAVVGYLEDIIMDDEFQLLQRNFMDKYYLEFEDTEENKLIYTPIFNEYISLVEKYIEEQLLQRIPEFNMAAFTTTLQHHKDEVAGDIFDMLLTFTDFLAFKEMFLDYRAEKEGRGLDLSSGLVVTSLCKSSSLPASQNNLRH

Molecular Formula

23568 (Gene_ID) Q9Y2Y0-1 (M1-H163) (Accession)

Molecular Weight

Approximately 21 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDZK1IP1 Over-expression Lysate Product
GWB-E025FB 0.1 mg

PDZK1IP1 Over-expression Lysate Product

Sign In for Pricing
View Details
ABflo® 647 Rabbit anti-Mouse CD10 mAb
A25705-01 50 Tests

ABflo® 647 Rabbit anti-Mouse CD10 mAb

Sign In for Pricing
View Details
ABflo® 647 Rabbit anti-Mouse CD10 mAb
A25705-02 100 Tests

ABflo® 647 Rabbit anti-Mouse CD10 mAb

Sign In for Pricing
View Details
ABflo® 647 Rabbit anti-Mouse CD10 mAb
A25705-03 200 Tests

ABflo® 647 Rabbit anti-Mouse CD10 mAb

Sign In for Pricing
View Details
ABflo® 647 Rabbit anti-Mouse CD10 mAb
A25705-04 500 Tests

ABflo® 647 Rabbit anti-Mouse CD10 mAb

Sign In for Pricing
View Details
VAMP2 Rabbit Polyclonal Antibody
TA351910 100 µL

VAMP2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details