Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lymphocyte antigen 6E/LY6E, Mouse (P.pastoris, His, SUMO)

LY6E is a GPI-anchored cell surface protein that regulates T lymphocyte function by binding to CD3Z/CD247, affecting proliferation, differentiation and activation.It modulates T cell receptor signaling and exhibits antiviral activity against mouse hepatitis virus.Lymphocyte antigen 6E/LY6E Protein, Mouse (P.pastoris, His, SUMO) is the recombinant mouse-derived Lymphocyte antigen 6E/LY6E protein, expressed by P.pastoris , with N-His, N-SUMO labeled tag.

Product Specifications

CAS Number

9007-83-4

Product Name Alternative

Lymphocyte antigen 6E/LY6E Protein, Mouse (P.pastoris, His, SUMO), Mouse, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lymphocyte-antigen-6e-ly6e-protein-mouse-p-pastoris-his-sumo.html

Purity

90

Smiles

LMCFSCTDQKNNINCLWPVSCQEKDHYCITLSAAAGFGNVNLGYTLNKGCSPICPSENVNLNLGVASVNSYCCQSSFCNFSA

Molecular Formula

17069 (Gene_ID) Q64253 (L27-A108) (Accession)

Molecular Weight

Approximately 24 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSZFP36 Antibody - N-terminal region : HRP (ARP50464_T100-HRP)
ARP50464_T100-HRP 100 µL

HSZFP36 Antibody - N-terminal region : HRP (ARP50464_T100-HRP)

Sign In for Pricing
View Details
CBX6 (NM_014292) Human 3' UTR Clone
SC217290 10 µg

CBX6 (NM_014292) Human 3' UTR Clone

Sign In for Pricing
View Details
Casc4 3'UTR GFP Stable Cell Line
TU153148 1.0 mL

Casc4 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Recombinant Human CD45/PTPRC Protein, C-Fc
bs-104261P-01 20 µg

Recombinant Human CD45/PTPRC Protein, C-Fc

Sign In for Pricing
View Details
Recombinant Human CD45/PTPRC Protein, C-Fc
bs-104261P-02 50 µg

Recombinant Human CD45/PTPRC Protein, C-Fc

Sign In for Pricing
View Details
TCR, V beta 4 (T Cell Receptor) (MaxLight 490) discontinued
T2040-18A-ML490 100 µL

TCR, V beta 4 (T Cell Receptor) (MaxLight 490) discontinued

Sign In for Pricing
View Details