UBE2D4, Human (GST)
The UBE2D4 protein is an important ubiquitin-proteasome system component that acts as an E2 ubiquitin-conjugating enzyme, accepting ubiquitin from the E1 complex and catalyzing its covalent attachment to proteins. In vitro, UBE2D4 exhibits multifunctionality by promoting polyubiquitination of all seven ubiquitin Lys residues, possibly favoring polyubiquitination of “Lys-11” and “Lys-48” linkages. UBE2D4 Protein, Human (GST) is the recombinant human-derived UBE2D4 protein, expressed by E. coli , with N-GST labeled tag.
Product Specifications
Product Name Alternative
UBE2D4 Protein, Human (GST), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/ube2d4-protein-human-gst.html
Smiles
MALKRIQKELTDLQRDPPAQCSAGPVGDDLFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPEIAHTYKADREKYNRLAREWTQKYAM
Molecular Formula
51619 (Gene_ID) Q9Y2X8 (M1-M147) (Accession)
Molecular Weight
Approximately 40 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Dry ice.
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items