Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBE2D4, Human (GST)

The UBE2D4 protein is an important ubiquitin-proteasome system component that acts as an E2 ubiquitin-conjugating enzyme, accepting ubiquitin from the E1 complex and catalyzing its covalent attachment to proteins. In vitro, UBE2D4 exhibits multifunctionality by promoting polyubiquitination of all seven ubiquitin Lys residues, possibly favoring polyubiquitination of “Lys-11” and “Lys-48” linkages. UBE2D4 Protein, Human (GST) is the recombinant human-derived UBE2D4 protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

UBE2D4 Protein, Human (GST), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ube2d4-protein-human-gst.html

Smiles

MALKRIQKELTDLQRDPPAQCSAGPVGDDLFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPEIAHTYKADREKYNRLAREWTQKYAM

Molecular Formula

51619 (Gene_ID) Q9Y2X8 (M1-M147) (Accession)

Molecular Weight

Approximately 40 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Tgfb3 Rat Pre-designed siRNA Set A
HY-RS23439 1 Set

Tgfb3 Rat Pre-designed siRNA Set A

Ask
View Details
CREG2 Polyclonal Antibody
UB-GEN-7051 100 µL

CREG2 Polyclonal Antibody

Ask
View Details
EBI3 Rabbit mAb
E60M3418 100 µL

EBI3 Rabbit mAb

Ask
View Details
GTP-binding protein RAD (RRAD) Rat ELISA Kit
D8869 96 Tests

GTP-binding protein RAD (RRAD) Rat ELISA Kit

Ask
View Details
Follistatin (FST) Rabbit Polyclonal Antibody
TA350675 100 µL

Follistatin (FST) Rabbit Polyclonal Antibody

Ask
View Details