Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-25/IL-17E, Human (HEK293, His)

IL-25/IL-17E cytokines are produced by eosinophils, Th2 cells, and epithelial cells and critically regulate the adaptive immune response by modulating cytokine production. It enhances local and systemic type 2 helper T cell responses through its IL17RA and IL17RB receptors and activates the JAK2-STAT5A pathway. IL-25/IL-17E Protein, Human (HEK293, His) is the recombinant human-derived IL-25/IL-17E protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

IL-25/IL-17E Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-25-il-17e-protein-human-hek293-his.html

Purity

98.0

Smiles

YSHWPSCCPSKGQDTSEELLRWSTVPVPPLEPARPNRHPESCRASEDGPLNSRAISPWRYELDRDLNRLPQDLYHARCLCPHCVSLQTGSHMDPRGNSELLYHNQTVFYRRPCHGEKGTHKGYCLERRLYRVSLACVCVRPRVMG

Molecular Formula

64806 (Gene_ID) Q9H293-1 (Y33-G177) (Accession)

Molecular Weight

Approximately 20-27 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyclonal Antibody to Fibrinopeptide B (FPB)
MBS2112102-01 0.1 mL

Polyclonal Antibody to Fibrinopeptide B (FPB)

Sign In for Pricing
View Details
Polyclonal Antibody to Fibrinopeptide B (FPB)
MBS2112102-02 0.2 mL

Polyclonal Antibody to Fibrinopeptide B (FPB)

Sign In for Pricing
View Details
Polyclonal Antibody to Fibrinopeptide B (FPB)
MBS2112102-03 0.5 mL

Polyclonal Antibody to Fibrinopeptide B (FPB)

Sign In for Pricing
View Details
Polyclonal Antibody to Fibrinopeptide B (FPB)
MBS2112102-04 1 mL

Polyclonal Antibody to Fibrinopeptide B (FPB)

Sign In for Pricing
View Details
Polyclonal Antibody to Fibrinopeptide B (FPB)
MBS2112102-05 5 mL

Polyclonal Antibody to Fibrinopeptide B (FPB)

Sign In for Pricing
View Details
Polyclonal Antibody to Fibrinopeptide B (FPB)
MBS2112102-06 5x 5 mL

Polyclonal Antibody to Fibrinopeptide B (FPB)

Sign In for Pricing
View Details