Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-25/IL-17E, Human (HEK293, His)

IL-25/IL-17E cytokines are produced by eosinophils, Th2 cells, and epithelial cells and critically regulate the adaptive immune response by modulating cytokine production. It enhances local and systemic type 2 helper T cell responses through its IL17RA and IL17RB receptors and activates the JAK2-STAT5A pathway. IL-25/IL-17E Protein, Human (HEK293, His) is the recombinant human-derived IL-25/IL-17E protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

IL-25/IL-17E Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-25-il-17e-protein-human-hek293-his.html

Purity

98.0

Smiles

YSHWPSCCPSKGQDTSEELLRWSTVPVPPLEPARPNRHPESCRASEDGPLNSRAISPWRYELDRDLNRLPQDLYHARCLCPHCVSLQTGSHMDPRGNSELLYHNQTVFYRRPCHGEKGTHKGYCLERRLYRVSLACVCVRPRVMG

Molecular Formula

64806 (Gene_ID) Q9H293-1 (Y33-G177) (Accession)

Molecular Weight

Approximately 20-27 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZSCAN16 CRISPR All-in-one AAV vector set (with saCas9)(Human)
51962151 3x 1.0 µg DNA

ZSCAN16 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Recombinant Human BPNT1 Protein
E30P4715 20 µg

Recombinant Human BPNT1 Protein

Sign In for Pricing
View Details
SPRED3 (NM_001039616) Human Tagged ORF Clone
RC218601 10 µg

SPRED3 (NM_001039616) Human Tagged ORF Clone

Sign In for Pricing
View Details
Cdk7 Polyclonal Antibody
BT-AP01638-01 20 µL

Cdk7 Polyclonal Antibody

Sign In for Pricing
View Details
Cdk7 Polyclonal Antibody
BT-AP01638-02 50 µL

Cdk7 Polyclonal Antibody

Sign In for Pricing
View Details
Cdk7 Polyclonal Antibody
BT-AP01638-03 100 µL

Cdk7 Polyclonal Antibody

Sign In for Pricing
View Details