IL-25/IL-17E, Human (HEK293, His)
IL-25/IL-17E cytokines are produced by eosinophils, Th2 cells, and epithelial cells and critically regulate the adaptive immune response by modulating cytokine production. It enhances local and systemic type 2 helper T cell responses through its IL17RA and IL17RB receptors and activates the JAK2-STAT5A pathway. IL-25/IL-17E Protein, Human (HEK293, His) is the recombinant human-derived IL-25/IL-17E protein, expressed by HEK293 , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
IL-25/IL-17E Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/il-25-il-17e-protein-human-hek293-his.html
Purity
98.0
Smiles
YSHWPSCCPSKGQDTSEELLRWSTVPVPPLEPARPNRHPESCRASEDGPLNSRAISPWRYELDRDLNRLPQDLYHARCLCPHCVSLQTGSHMDPRGNSELLYHNQTVFYRRPCHGEKGTHKGYCLERRLYRVSLACVCVRPRVMG
Molecular Formula
64806 (Gene_ID) Q9H293-1 (Y33-G177) (Accession)
Molecular Weight
Approximately 20-27 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
PLGF (Placental Growth Factor, Vascular Endothelial Growth Factor-related Protein) (Biotin) discontinued
PCGF2, ID (PCGF2, MEL18, RNF110, ZNF144, Polycomb group RING finger protein 2, DNA-binding protein Mel-18, RING finger protein 110, Zinc finger protein 144) (MaxLight 750) discontinued
ROR2 (Receptor Tyrosine Kinase-like orphan Receptor 2, BDB, BDB1, MGC163394, NTRKR2) (MaxLight 405)
ROR2 (Receptor Tyrosine Kinase-like orphan Receptor 2, BDB, BDB1, MGC163394, NTRKR2) (MaxLight 405)
Recombinant Bacillus subtilis Putative spore germination protein yfkR (yfkR)
